NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095809

Metagenome Family F095809

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095809
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 61 residues
Representative Sequence MGVRNSNTGAKRRTRLGLALEQSAKEILAHLKGDARLPTRRIVLPNEVDVKRIRTRAGMS
Number of Associated Samples 91
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.33 %
% of genes near scaffold ends (potentially truncated) 82.86 %
% of genes from short scaffolds (< 2000 bps) 89.52 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.238 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.381 % of family members)
Environment Ontology (ENVO) Unclassified
(37.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.048 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.41%    β-sheet: 0.00%    Coil/Unstructured: 71.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF06296RelE 36.19
PF00004AAA 2.86
PF00266Aminotran_5 1.90
PF01725Ham1p_like 1.90
PF03466LysR_substrate 1.90
PF01564Spermine_synth 0.95
PF01156IU_nuc_hydro 0.95
PF13360PQQ_2 0.95
PF01850PIN 0.95
PF07731Cu-oxidase_2 0.95
PF03796DnaB_C 0.95
PF00762Ferrochelatase 0.95
PF10569Obsolete Pfam Family 0.95
PF02321OEP 0.95
PF01053Cys_Met_Meta_PP 0.95
PF00692dUTPase 0.95
PF13683rve_3 0.95
PF04221RelB 0.95
PF06940DUF1287 0.95
PF04326AlbA_2 0.95
PF07883Cupin_2 0.95
PF00202Aminotran_3 0.95
PF07927HicA_toxin 0.95
PF03725RNase_PH_C 0.95
PF04734Ceramidase_alk 0.95
PF11954DUF3471 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG4737Uncharacterized conserved proteinFunction unknown [S] 36.19
COG0127Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase familyNucleotide transport and metabolism [F] 1.90
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.90
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.95
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.95
COG0276Protoheme ferro-lyase (ferrochelatase)Coenzyme transport and metabolism [H] 0.95
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.95
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.95
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.95
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.95
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.95
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.95
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.95
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.95
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.95
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.95
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.95
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.95
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.95
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.95
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.95
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.95
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 0.95
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.95
COG3077Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin moduleDefense mechanisms [V] 0.95
COG3738Uncharacterized conserved protein YijF, DUF1287 familyFunction unknown [S] 0.95
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.24 %
UnclassifiedrootN/A4.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003886|Ga0063293_10407961All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300004082|Ga0062384_100099580All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300004082|Ga0062384_100675944All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300004091|Ga0062387_100627087All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300004092|Ga0062389_100608179All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300004152|Ga0062386_101557446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4551Open in IMG/M
3300004635|Ga0062388_101398642All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005434|Ga0070709_11603692All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005435|Ga0070714_100840250All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300005458|Ga0070681_11006949All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300005467|Ga0070706_100932610All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300005542|Ga0070732_10744790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter597Open in IMG/M
3300005591|Ga0070761_10355005All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005598|Ga0066706_10479681All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300005602|Ga0070762_10428814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3856Open in IMG/M
3300006055|Ga0097691_1003856All Organisms → cellular organisms → Bacteria → Acidobacteria9063Open in IMG/M
3300006176|Ga0070765_100241673All Organisms → cellular organisms → Bacteria1653Open in IMG/M
3300006638|Ga0075522_10150893All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009089|Ga0099828_11531715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4588Open in IMG/M
3300009090|Ga0099827_11381277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4613Open in IMG/M
3300009509|Ga0123573_10906973All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300009525|Ga0116220_10203225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4859Open in IMG/M
3300009548|Ga0116107_1171520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4585Open in IMG/M
3300009549|Ga0116137_1026975All Organisms → cellular organisms → Bacteria2056Open in IMG/M
3300009623|Ga0116133_1230097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter504Open in IMG/M
3300009644|Ga0116121_1124098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4813Open in IMG/M
3300010371|Ga0134125_11970731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter635Open in IMG/M
3300010379|Ga0136449_101781539All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. Root1444923Open in IMG/M
3300011119|Ga0105246_10967815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia768Open in IMG/M
3300012096|Ga0137389_11782350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4511Open in IMG/M
3300012205|Ga0137362_10386498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41212Open in IMG/M
3300012205|Ga0137362_11734299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter511Open in IMG/M
3300012285|Ga0137370_10866103All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012357|Ga0137384_10649631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4859Open in IMG/M
3300014155|Ga0181524_10207346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4954Open in IMG/M
3300014159|Ga0181530_10257431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076932Open in IMG/M
3300014201|Ga0181537_11164539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4521Open in IMG/M
3300014491|Ga0182014_10026005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4707Open in IMG/M
3300014492|Ga0182013_10043300All Organisms → cellular organisms → Bacteria3533Open in IMG/M
3300014494|Ga0182017_10375677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4882Open in IMG/M
3300014494|Ga0182017_10485450All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300014495|Ga0182015_11018044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300014496|Ga0182011_10243564All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300014496|Ga0182011_10861649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4565Open in IMG/M
3300014496|Ga0182011_10897680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4552Open in IMG/M
3300014502|Ga0182021_11268637All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300014839|Ga0182027_11437345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4681Open in IMG/M
3300017931|Ga0187877_1094756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41256Open in IMG/M
3300017946|Ga0187879_10047331All Organisms → cellular organisms → Bacteria → Acidobacteria2540Open in IMG/M
3300017946|Ga0187879_10254475All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300017946|Ga0187879_10460806All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300017946|Ga0187879_10657521All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300018007|Ga0187805_10191695All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300018012|Ga0187810_10394678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4581Open in IMG/M
3300018014|Ga0187860_1121085All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300018019|Ga0187874_10298664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter656Open in IMG/M
3300018020|Ga0187861_10128620All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300018030|Ga0187869_10566456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4539Open in IMG/M
3300018033|Ga0187867_10358958All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300018035|Ga0187875_10238342Not Available995Open in IMG/M
3300018038|Ga0187855_10502464All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018038|Ga0187855_10605455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4638Open in IMG/M
3300018084|Ga0184629_10308336All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300020074|Ga0194113_10055775All Organisms → cellular organisms → Bacteria3774Open in IMG/M
3300020074|Ga0194113_10193901All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300020083|Ga0194111_10847295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4547Open in IMG/M
3300020222|Ga0194125_10060045All Organisms → cellular organisms → Bacteria3552Open in IMG/M
3300022551|Ga0212089_10293677All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300025472|Ga0208692_1044874All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300025473|Ga0208190_1111553Not Available530Open in IMG/M
3300025579|Ga0207927_1002554All Organisms → cellular organisms → Bacteria7388Open in IMG/M
3300025619|Ga0207926_1084087Not Available800Open in IMG/M
3300025888|Ga0209540_10530800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4611Open in IMG/M
3300025929|Ga0207664_10698013All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300026294|Ga0209839_10124169Not Available867Open in IMG/M
3300027854|Ga0209517_10269117All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300027854|Ga0209517_10417646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4750Open in IMG/M
3300027905|Ga0209415_10096218All Organisms → cellular organisms → Bacteria3283Open in IMG/M
3300027905|Ga0209415_10510117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076923Open in IMG/M
(restricted) 3300028043|Ga0233417_10497946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4571Open in IMG/M
(restricted) 3300028571|Ga0247844_1183495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter811Open in IMG/M
3300028906|Ga0308309_10106003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2184Open in IMG/M
3300029910|Ga0311369_11349481Not Available542Open in IMG/M
3300029943|Ga0311340_10665312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4898Open in IMG/M
3300029987|Ga0311334_11463164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4578Open in IMG/M
3300030002|Ga0311350_11509268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4596Open in IMG/M
3300030114|Ga0311333_11085496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4681Open in IMG/M
3300030707|Ga0310038_10087823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1652Open in IMG/M
3300031028|Ga0302180_10245653All Organisms → cellular organisms → Bacteria → Proteobacteria942Open in IMG/M
3300031234|Ga0302325_11239802All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300031235|Ga0265330_10330483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300031446|Ga0170820_16565494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4575Open in IMG/M
3300031525|Ga0302326_11966393All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031525|Ga0302326_12385471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4668Open in IMG/M
3300031788|Ga0302319_11543076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4589Open in IMG/M
3300033158|Ga0335077_12205564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4506Open in IMG/M
3300033402|Ga0326728_10022051All Organisms → cellular organisms → Bacteria11875Open in IMG/M
3300033402|Ga0326728_10860121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4650Open in IMG/M
3300033480|Ga0316620_10696477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4966Open in IMG/M
3300033489|Ga0299912_11251102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4538Open in IMG/M
3300033521|Ga0316616_100383541All Organisms → cellular organisms → Bacteria → Proteobacteria1547Open in IMG/M
3300033890|Ga0334810_024189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41535Open in IMG/M
3300033891|Ga0334811_043275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41224Open in IMG/M
3300034089|Ga0373913_0196731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300034091|Ga0326724_0537526All Organisms → cellular organisms → Bacteria592Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.67%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.81%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.86%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.86%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.90%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.90%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.95%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.95%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.95%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.95%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.95%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003886Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034089Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.2EngineeredOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0063293_1040796123300003886Hydrothermal VentsMIMDPHKRKTTAKRRTKFGLEMEESAKEILAHVKGETQLPTRRIVLPEEVDVKRIRR*
Ga0062384_10009958013300004082Bog Forest SoilMGVRNLNTATRRRTQFGVALEQSAKEILAHVKGDAKLTTRRIVLPGEVDVRGIRT
Ga0062384_10067594423300004082Bog Forest SoilMGVRNKRTGIGKRTGLGIALEQSAKEILAHMKGDAKLPTRRIVLPDEVDVKRIR
Ga0062387_10062708723300004091Bog Forest SoilMVARKSKTRAKSSRTKLGLALEQSAKEILAHAKGDAKLPTRRMVLPGEVDVKRIRIRARMSQAEFARAFCIN
Ga0062389_10060817923300004092Bog Forest SoilMGVRKLNAGARKRTKLGLTLEESAKEILAHVKGEAKLLTRRIALPDEADVKRIRTLAPFTATP*
Ga0062386_10155744623300004152Bog Forest SoilMGVRNLKTGVGRRTKLGMELERSAQEILAHLKGDARLPTRRIVLPDEVDVKRIRTK
Ga0062388_10139864213300004635Bog Forest SoilRKRTKLGLTLEESAKEILAHVKGEAKLLTRRIALPDEADVKRIRTLAPFTATP*
Ga0070709_1160369223300005434Corn, Switchgrass And Miscanthus RhizosphereMYRRNLKMGTGKRTKLGLALEQSAKEILAHVKGASRLPTRRIVLPDEVDVKRIRIKA
Ga0070714_10084025023300005435Agricultural SoilMRKLKTGDKRRTKLGLALEQGAKEILAHLKGEARLPVRRIVLPDEVDVKRARTKARMSQAEFA
Ga0070681_1100694913300005458Corn RhizosphereMRKLKTGDKRRTKLGLALEQGAKEILAHLKGEARLPVRRIVLPDEVDVKR
Ga0070706_10093261013300005467Corn, Switchgrass And Miscanthus RhizosphereMDRRNLKIGTGKRTKLGLALEQSAKEILAHVKGESRLPVRRIVLPDEVDVKRIRIKAGMSQSEF
Ga0070732_1074479023300005542Surface SoilMGVRTVNTGTKRRTKLGRALEQSAKEILAHIKGDLRLPARRIVLPDEVDV
Ga0070761_1035500513300005591SoilMSGVRNSNTGTKRRTKLGLALEQSAKEILAHVKGEARLPTRRIVLPDEVDVKRIRT
Ga0066706_1047968123300005598SoilMGVRNLNPGTKRRAKLGIALEQSAKEILAHVKGDTRLPTRRVVLPDEVDVKLIRTRAR
Ga0070762_1042881413300005602SoilMSARKSNKGAQKRTKLGLALEQSAKEILAHVKGDARLPTRRIVLPDEVDVKHIRTKARMSQAEFA
Ga0097691_100385613300006055Arctic Peat SoilLEVCNWNTGAKGRTKLGMALEQSAKEILAHVNGDARLPTRHIVLPDEVDVKRIRRAAEPA
Ga0070765_10024167333300006176SoilMNVRKSKTRAKSSRTNVGLALERSAREILAHVKGEAKLPSRRIVLPDEVDLKRIRTN*
Ga0075522_1015089323300006638Arctic Peat SoilMGARISKTGVKKRTKLGLGLERGAKEILAHVKGDARLPVRGIVLPDEVDVKRVRTKAHISP*
Ga0099828_1153171523300009089Vadose Zone SoilMRVRNLKTGAKTRTKLGLALEQSAKEILAHVKGETRLPARRIVLPDEVDVKRLRTKARMSQA
Ga0099827_1138127713300009090Vadose Zone SoilMGVRNSKTKRRTRLGLALEQSAKEILAHVMGDARLPTRHIVLPDEVDVKRIRTKAGMSQAEFARAFCINPRTLQE
Ga0123573_1090697313300009509Mangrove SedimentMDVRNSRTRAKRRTQLGLALEQSAKEILAHVKGEARLPARRIVLPDEVDVKRIRTQRPARTSL*
Ga0116220_1020322533300009525Peatlands SoilMGVRRSKNGGRTKLGLALEKSANEILAHVKGEMRLPARRIVLPEEVDVKRVRAKARMSQAEF
Ga0116107_117152023300009548PeatlandMGVRNLNTGTKSRTEFGMALEQSAKEILAHVKGDVRLPARRIVLPDEVDVKSIRTKAGMS
Ga0116137_102697513300009549PeatlandMGVRNLNTGTKSRTEFGMALEQSAKEILAHVKGDVRLPTRRIVLPDEVDVKRIRTKAGMSQAEF
Ga0116133_123009713300009623PeatlandMNMGARTRETGSKSRTKLGITLEQSAKEILAHLKGNALLPAQRIVLPDEVD
Ga0116121_112409833300009644PeatlandMGVRTAKTGTKDRTKLGIELEQSAREILAHVKGDVRLPTRRIVLPDEVDVKRIRTKARMSQAEFARAFCINPRTL
Ga0134125_1197073113300010371Terrestrial SoilMGAKKLKTGHHRRTKFGLALEQSAKEILAHVKGEAKLPTRRIVLPDEVDVKRIRARAGMSQAEFARAFCINPRTLQE
Ga0136449_10178153943300010379Peatlands SoilMMMAVRNLNTGTTRRTKLGMALERSAREILAYVKGDVKLPTRRIVLPDEVDVKRVRTKPQYS
Ga0105246_1096781513300011119Miscanthus RhizosphereMPARKVKTGSRTKFGLALEQSASEILAHVKAEAKLPTRRIVLPDEVDVRRIRARARMSQAEFARA
Ga0137389_1178235023300012096Vadose Zone SoilMGLRNSNTKTTRRTRLGVALEQSAKEILAHVMGDARLPTRRIVLPDEVNVKRIRTKAGMSQAEFARAFCINPRTL
Ga0137362_1038649833300012205Vadose Zone SoilMSISLHKPKTAIKKRTKFGLALEESAKEILAHVKGETILRTRRIVLPDDVDVRRIRSEARMSQAEFARAFCINPRT
Ga0137362_1173429923300012205Vadose Zone SoilMKRRTKLGISLEQSAKEILAHVKGNLSLPTRRIILPDEVDVKRIRTKARMSQAQFARAFC
Ga0137370_1086610313300012285Vadose Zone SoilMGVRNLNPGTKRRTKLGIALEQSAKEILAHVKGDARLPTRRVVLPDEVDVKLIRTRARMSQAEFARAFCINPRT
Ga0137384_1064963123300012357Vadose Zone SoilMGVRNLNTGAKKRTNYGLALEQSAKEILAHLKGGARLPTRRIVLPDEIDVKRIRTKAR
Ga0181524_1020734613300014155BogMGLRAGNTGTKGRTKLGMVLERSAKEILAHVKGDVRLPTRRIVLPDEVDVKRIRTKARMSQAE
Ga0181530_1025743123300014159BogMGVRDLNAGTKSRTKFGMALELSAKEILAHVKGDVRLPTRRIVLPDEVDVKRV
Ga0181537_1116453913300014201BogMNMGARTRETGSKSRTKLGITLEQSAKEILAHLKGNALLPAQRIVLPDEVDVKRIRTKARMSQAE
Ga0182014_1002600533300014491BogMGVRPAKTGTKDRTKLGIELERSAREILAHVKGDVKLPTRRIVLPDEVDVKGSGLL*
Ga0182013_1004330043300014492BogMVMRKMSTGTKGRTKLMALEQSAKEILAHVKGETRLPTRRIVLPDEVDVKRIRTEAGMSQAEFARAFCLN
Ga0182017_1037567713300014494FenMGVRNLNAGTKGRTKFGMALEQSAKEILAHMKGDVRLPTRRIVLPDEVDVKRIRTE
Ga0182017_1048545033300014494FenMGVRNLNTGAGRRTKLGMELERSAEEILAHFKGNVTLRTRRIVLPDEVDVKRIRTKA
Ga0182015_1101804423300014495PalsaMAKTKTTRRTQLGLALEQSAKEILSHMKGEARFPTRRLVLPGEV
Ga0182011_1024356423300014496FenMGAHSSNTGAERRTKRGLALKESAKEILAHVKGEAKLSTRRIVLPESKPLAS*
Ga0182011_1086164913300014496FenMGVRNLNTGAGRRTKLGMELERSAKEILAHLNGDTRLPTRRSVLPDEVDVKRIRTKAGMS
Ga0182011_1089768023300014496FenMGVRNLNTGAGRRTKLGMELERSAKVILAHLKGDVRLHTRRIVLPNEVDVKRIRTKAGMSQAEFARA
Ga0182021_1126863733300014502FenMGVRNLNAGTKSRTKFGMALEQSAKEILAHVKGDVRLPTRRIVLPDEVDVKRIRTEAGMSQAEFARAFCINPRTL
Ga0182027_1143734513300014839FenMTMSVLNAKTGAGKRTRHGLALEESAKEILAHVKGELKLPTRRVVLPDEVDVKRIRTK
Ga0187877_109475613300017931PeatlandMSVRIQKAGAKRRTRLGLALEESAREILAHVKGEKVLPTRRILLPEEVDVKRIRAK
Ga0187879_1004733123300017946PeatlandMDVRNLNARIDRRTRLGRELEQSAKEIPAHVKGEARLPTGLIVLPDEIDVKRIRTKGVCRKQSSRGRFA
Ga0187879_1025447533300017946PeatlandMSLPAQKARAKRRTKLGLALEESAREILAHVKGEKTFPTRRIALPKEVD
Ga0187879_1046080623300017946PeatlandVAASGNLFPLSGKRTELGLALEESAKEILAHVKGEKALPTQRLVLPDEVAVKRTRKRARMSQSGFA
Ga0187879_1065752113300017946PeatlandMGARNLKSRTKRRTLLGISLEQSAKEILAHVKGDARLPTRRIVLPDEVDVKRIRTKARMSQAEFARLLH
Ga0187805_1019169513300018007Freshwater SedimentMSSRSSKVVRKPRTNLGLALEGSAREILAHLKGEKDLSVRQLVLPDEVDIKRIRSKTAMSQAEFARAF
Ga0187810_1039467823300018012Freshwater SedimentVRTRKSNIAKRTKLGKALEQSANQILAHVKGELRLPTRRIVLPGEVDVKRIRTKARMSQAEFARAFCINPR
Ga0187860_112108523300018014PeatlandMGVRNLNTRATRRTKLGLALEQSAREILAHVKGDSKRPTCRIVLPDEVDVK
Ga0187874_1029866413300018019PeatlandMGVRTTDNGTKGRTKFGLEVEQSAKEILAHVKGEAKLPTRRIVLPNEVDVKRIRTRARMSQAEFARAFCINP
Ga0187861_1012862043300018020PeatlandMPYSEGAMGVRNSDTGAGRRTKLGVALEGSAEEILAHVKGDVRLPARRIVL
Ga0187869_1056645613300018030PeatlandMGVHKMNRGTEGRTKLGMALEQSAKEILAHVKGETRLPTRRIVLPDEVDVKRI
Ga0187867_1035895833300018033PeatlandMGVRTAKTGTKDRTKLGIELEQSAREILAHVKGDVRLPTRRIVLPDEVDVKRIRTKARMS
Ga0187875_1023834223300018035PeatlandMGVRNLSAGTKGRTRLGRELEQSANEILAHVKGEVRLPTRRLVLPDEIDVKRIRTDARMSQVAFARAHTSR
Ga0187855_1050246423300018038PeatlandVKVGMSKRKVEAGKRTKLGLALEESAKEILAHVKGEKALPTQRLVLPDEVAVKRTRKRARMSQSGFAAAFCRNPRTLQESEAVLRALAS
Ga0187855_1060545523300018038PeatlandMGVRTAKTGTKDRTKLGIELEQSAREILAHVKGDVRLPTRRIVLPDEVDVKR
Ga0184629_1030833613300018084Groundwater SedimentMGVRNSNTGAKRRTRLGLALEQSAKEILAHLKGDARLPTRRIVLPNEVDVKRIRTRAGMS
Ga0194113_1005577553300020074Freshwater LakeMKTKAAAERTKFGRELAESAREILAHLKGETNLPVLRIVMPDEIDVAEVRGATGMSQAEFARAFCINPRTLQE
Ga0194113_1019390133300020074Freshwater LakeVGVRNVKTPSKRRTKLGLTLEQSAKEILAHVKGEAQLPTRRIVLPDEVNVKRIRSKVGMSQAEFARAFCIN
Ga0194111_1084729523300020083Freshwater LakeVGVGKMSTPSKRRTQLGLVLEQGAKEILAHVKGEAQLPTRRIVLANEVNVKRIRTMSAII
Ga0194125_1006004513300020222Freshwater LakeVGVGKMSTPSKRRTQLGLVLEQGAKEILAHVKGEAQLPTRRIVLANEVNVKRIRTKAGMSQAEFARAFCINPRT
Ga0212089_1029367723300022551Lake SedimentMGMRNRKTRAKERTRLGLALEQSAKEILAHVKGEAKLPTRRIVLPDEVDVKRIRAKAGMSQAEFARAFCINPRTLQE
Ga0208692_104487433300025472PeatlandMGVRNLNTGTKSRTEFGMALEQSAKEILAHVKGDVRLPTRRIVLPDEVDVKRIRTKAGMSQAEFARAFCIN
Ga0208190_111155323300025473PeatlandMDVRNLNARIDRRTRLGRELEQSAKEIPAHVKGEARLPTGLIVLPDEIDVKRIRTKGVCRKQSSR
Ga0207927_1002554103300025579Arctic Peat SoilLEVCNWNTGAKGRTKLGMALEQSAKEILAHVNGDARLPTRHIVLPDEVDVKRIRRAAEPAENA
Ga0207926_108408713300025619Arctic Peat SoilLEVCNWNTGAKGRTKLGMALEQSAKEILAHVNGDARLPTRHIVLPDEVDVKRIRR
Ga0209540_1053080013300025888Arctic Peat SoilMGAHNLNTGTKRRTKLGMALEQSAKEILAHVKGDARLPTRRIVLPDEVDVK
Ga0207664_1069801313300025929Agricultural SoilMRKLKTGDKRRTKLGLALEQGAKEILAHLKGEARLPVRRIVLPDEVDVKRARTKARMSQAEFAQAFCINPR
Ga0209839_1012416913300026294SoilMRVRRSNTALKSRTKLGMSLEQSAREILAHVKGNATLNTRRIVLPDEVDVKRIRTKARM
Ga0209517_1026911733300027854Peatlands SoilMGVRSLNTGVNRRTKLGVALEESARQILAHVKGDARLPTRRIVLPDEIDVKRIRNKARMSQAEFAR
Ga0209517_1041764633300027854Peatlands SoilMSVRKLNTGAGKRTKFGLELEQSAKEILAHLKGEARLPTRRIVLPDEVDVKRIRAKAGMSQAEF
Ga0209415_1009621813300027905Peatlands SoilMGTRNLNTGTKRRTEFGIALEQSAREILAHVKGDATLTTRRIVLPDEVDV
Ga0209415_1051011713300027905Peatlands SoilMSTSTRSTGTQKRTELGLALEESAKEILAHLRGQKRLPTRRVVLPNEV
(restricted) Ga0233417_1049794623300028043SedimentMGMRNRKARAKERTRLGLALEQSAKEILAHVKGEAKLPTRRIVLPDEVDVKRIRAKAGMSQAEFARAFCIN
(restricted) Ga0247844_118349513300028571FreshwaterMPTRQPKSANNKRTKLGLELEASARDILAHIKGEKTFPTRRIVLPEEVDVKRIRTAAGM
Ga0308309_1010600323300028906SoilMNVRKSKTRAKSSRTNVGLALERSAREILAHVKGEAKLPSRRIVLPDEVDLKRIRTN
Ga0311369_1134948113300029910PalsaMTMGVRKLNTEAKRRTKLGLALEQSANEILAHVKGDARLPTRRIILPDEVKVKRIRTKSGMS
Ga0311340_1066531233300029943PalsaMGVRNSKAGTKKRTKLGLELEQSAREILAHVKGDLRLPTRRLVLPDEVDVK
Ga0311334_1146316413300029987FenMGVRNLNTGAGRRTRLGMELERSAKEILAHLKGDARLPTRRIVLPDAVDVKRIRTKA
Ga0311350_1150926813300030002FenMRVSSSKVGTKKRTKIGLELEQSAREILAHLKGDLKLPTRRIVLPDEVDVKRIRNK
Ga0311333_1108549623300030114FenMGVRGLKTGNKSRTKLGMALEQSAKEILAHVKGDAVLPTRRVVLPGQVDVKRIRTKAGMSQAEFARAF
Ga0310038_1008782313300030707Peatlands SoilMGVRKLNTGTKRRTKPGLELEQGAKEILAHVKGKARLPTRRIVLP
Ga0302180_1024565313300031028PalsaMGVRTVNTGTKGRTKFGMALEQSAREILAHVKGDVRLPARRVVLPDEIDVKRIRTKARMSQAE
Ga0302325_1123980223300031234PalsaVKTETKRRTRLGIALEQSAKEILAHVKGEVRLPSRRIVLPNEVDVRRIRTKAKMSQAEGLDET
Ga0265330_1033048313300031235RhizosphereMGIRKMNTAGKRRTKLGLALEQSAKEILAHVKGDARRPTRRIVLPDEVNVKRLRTESGMSQAEFARAFCINP
Ga0170820_1656549413300031446Forest SoilMEVRNASTGTRRRTKLGLALEQSAKEILAHVKGDVKLPTRRIVLPDEVDVKR
Ga0302326_1196639313300031525PalsaVGVRKLNTGANKRTRLGLALEQSAKEILAHVKGEAKLPTRRIILPDEVGVKRSLQPRARTSR
Ga0302326_1238547113300031525PalsaMGARNLNVLSKRRTKLGIALEQSAREILAHVKGDAKLPTRSIVLPDEVDVKLIRTRARMSQAQFARAFFINPR
Ga0302319_1154307613300031788BogMSVRNSKRAHTGRTRLGLALEQSAKEILAHVKGEARLPTRRIVLPG
Ga0335077_1220556413300033158SoilMNMSVLNAKSGANRRTPHGLALEESAKEILAHVKGELRLPTRRIVLPEEVDVKRIRA
Ga0326728_1002205113300033402Peat SoilMGVPNLNTGTKSRTKFGMALEQSAKEILAHVKGDVRLPARRIVLPDEVDVKSIRTKAGMS
Ga0326728_1086012133300033402Peat SoilMSTSKPNTGTGKRTRLGLALEESAREILAHVKGETTLPTRRVVLPKEVNVKRLRERARMSQSEFASAF
Ga0316620_1069647713300033480SoilMGVRILNTGTKRRTKLGMELEQGAREILAHVKGDVRLPTRRIVLPDEVNVKRI
Ga0299912_1125110223300033489SoilMGVRNLDTKAKRRTRPGLALEESAREILAHVKGETRLPTRRIVLPDEIDVKRIR
Ga0316616_10038354123300033521SoilMIMGIRRSKAAAKGRTKLGLALEASAKEILAHVKGETKLATRRIVLSDEVAGACQAL
Ga0334810_024189_3_1913300033890SoilMGMRNLKTGVGRRTKLGMELERSAQEILAHLKGDARLPTRRIVLPNEVDVKRIRTKAGMSQAE
Ga0334811_043275_1079_12223300033891SoilMGVRKSNTGVGRRTKLGMELERSAEEILAHLNGDVRLPTRRIVLPDEV
Ga0373913_0196731_2_1453300034089Sediment SlurryMGVRNLDTKAKRRTRPGLALEESAREILAHVKGETRLPTRRIVLPDEV
Ga0326724_0537526_1_2283300034091Peat SoilMRVRNLNKGTKIRTRLGTTLEPSAKEILAHVKGDSVLPTRRIALPDEVDVKRIRTKAKMSQAEFARAFCINPRTLQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.