NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095712

Metagenome / Metatranscriptome Family F095712

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095712
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 40 residues
Representative Sequence MLPACRTAGEGFAIPTFDVVPSDVEGFMEELWEFQ
Number of Associated Samples 76
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.35 %
% of genes near scaffold ends (potentially truncated) 80.00 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(36.190 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.190 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.46%    β-sheet: 0.00%    Coil/Unstructured: 82.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13546DDE_5 7.62
PF13561adh_short_C2 1.90
PF00239Resolvase 1.90
PF13613HTH_Tnp_4 1.90
PF13191AAA_16 0.95
PF00501AMP-binding 0.95
PF00496SBP_bac_5 0.95
PF00583Acetyltransf_1 0.95
PF07681DoxX 0.95
PF13580SIS_2 0.95
PF13186SPASM 0.95
PF00535Glycos_transf_2 0.95
PF13565HTH_32 0.95
PF01609DDE_Tnp_1 0.95
PF03150CCP_MauG 0.95
PF02371Transposase_20 0.95
PF11295DUF3096 0.95
PF12728HTH_17 0.95
PF00872Transposase_mut 0.95
PF00589Phage_integrase 0.95
PF01850PIN 0.95
PF00144Beta-lactamase 0.95
PF13551HTH_29 0.95
PF03631Virul_fac_BrkB 0.95
PF13384HTH_23 0.95
PF12762DDE_Tnp_IS1595 0.95
PF08241Methyltransf_11 0.95
PF12974Phosphonate-bd 0.95
PF07690MFS_1 0.95
PF02515CoA_transf_3 0.95
PF13473Cupredoxin_1 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 1.90
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 1.90
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.95
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.95
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.95
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.95
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.95
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.95
COG2367Beta-lactamase class ADefense mechanisms [V] 0.95
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.95
COG3293TransposaseMobilome: prophages, transposons [X] 0.95
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.95
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.95
COG3547TransposaseMobilome: prophages, transposons [X] 0.95
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.95
COG5421TransposaseMobilome: prophages, transposons [X] 0.95
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.95
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.10 %
UnclassifiedrootN/A41.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100322770Not Available502Open in IMG/M
3300002912|JGI25386J43895_10084575Not Available843Open in IMG/M
3300004633|Ga0066395_10467943All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005332|Ga0066388_101266657All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1267Open in IMG/M
3300005332|Ga0066388_105152270Not Available663Open in IMG/M
3300005554|Ga0066661_10602082Not Available652Open in IMG/M
3300005555|Ga0066692_10888734Not Available546Open in IMG/M
3300005562|Ga0058697_10609863Not Available571Open in IMG/M
3300005574|Ga0066694_10269497All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005764|Ga0066903_100158421All Organisms → cellular organisms → Bacteria3275Open in IMG/M
3300005764|Ga0066903_100158449All Organisms → cellular organisms → Bacteria3275Open in IMG/M
3300005764|Ga0066903_101203822Not Available1407Open in IMG/M
3300005764|Ga0066903_101830959All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1160Open in IMG/M
3300005764|Ga0066903_103047425Not Available907Open in IMG/M
3300005764|Ga0066903_103162942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae891Open in IMG/M
3300005764|Ga0066903_103466818Not Available850Open in IMG/M
3300005764|Ga0066903_107298887All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Latescibacteria bacterium SCGC AAA252-D10571Open in IMG/M
3300005981|Ga0081538_10300145All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Latescibacteria bacterium SCGC AAA252-D10590Open in IMG/M
3300006196|Ga0075422_10274389All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300006800|Ga0066660_11460721All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006844|Ga0075428_100085040All Organisms → cellular organisms → Bacteria → Proteobacteria3450Open in IMG/M
3300006845|Ga0075421_100412175All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300006845|Ga0075421_100533136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41390Open in IMG/M
3300006846|Ga0075430_100221838All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300006854|Ga0075425_100746556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G91123Open in IMG/M
3300006876|Ga0079217_10511191All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300006969|Ga0075419_10315044All Organisms → Viruses → Predicted Viral1057Open in IMG/M
3300006969|Ga0075419_10913832All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300007004|Ga0079218_13796916All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009038|Ga0099829_11422867All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae573Open in IMG/M
3300009090|Ga0099827_10338818All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300009100|Ga0075418_12526460Not Available561Open in IMG/M
3300009147|Ga0114129_12215253Not Available661Open in IMG/M
3300009156|Ga0111538_12048609Not Available719Open in IMG/M
3300009691|Ga0114944_1171861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria857Open in IMG/M
3300010043|Ga0126380_10008418All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes4510Open in IMG/M
3300010044|Ga0126310_11610532All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010046|Ga0126384_10635519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4939Open in IMG/M
3300010046|Ga0126384_10955467Not Available777Open in IMG/M
3300010047|Ga0126382_10043591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis2573Open in IMG/M
3300010048|Ga0126373_10135646All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300010322|Ga0134084_10341935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300010359|Ga0126376_10450316Not Available1176Open in IMG/M
3300010359|Ga0126376_10808731Not Available916Open in IMG/M
3300010359|Ga0126376_12028256Not Available618Open in IMG/M
3300010360|Ga0126372_11681340All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300010360|Ga0126372_12535597All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010361|Ga0126378_10716398All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300010366|Ga0126379_10132557All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina2287Open in IMG/M
3300010366|Ga0126379_10587772All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300010366|Ga0126379_12664989All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010366|Ga0126379_12910697Not Available573Open in IMG/M
3300010366|Ga0126379_13405243Not Available533Open in IMG/M
3300010398|Ga0126383_10807314All Organisms → cellular organisms → Bacteria → Proteobacteria1021Open in IMG/M
3300010398|Ga0126383_12099037All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012285|Ga0137370_10157844All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300012350|Ga0137372_11169229All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012356|Ga0137371_10623219Not Available828Open in IMG/M
3300012362|Ga0137361_10943659All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012407|Ga0134050_1012545Not Available598Open in IMG/M
3300012929|Ga0137404_11005583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium763Open in IMG/M
3300012948|Ga0126375_10922968Not Available704Open in IMG/M
3300012948|Ga0126375_11368810Not Available598Open in IMG/M
3300012948|Ga0126375_11441249All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300012971|Ga0126369_10868473Not Available986Open in IMG/M
3300012971|Ga0126369_12332878Not Available621Open in IMG/M
3300012971|Ga0126369_12761866Not Available574Open in IMG/M
3300012971|Ga0126369_13533728Not Available512Open in IMG/M
3300012971|Ga0126369_13690044Not Available502Open in IMG/M
3300014487|Ga0182000_10603435All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300015373|Ga0132257_102010521All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300016319|Ga0182033_10839656Not Available811Open in IMG/M
3300016387|Ga0182040_11744294All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300018084|Ga0184629_10662339All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria528Open in IMG/M
3300018468|Ga0066662_11697559Not Available660Open in IMG/M
3300021560|Ga0126371_10349186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1614Open in IMG/M
3300025149|Ga0209827_10128843Not Available1732Open in IMG/M
3300025910|Ga0207684_10874818All Organisms → cellular organisms → Bacteria → Proteobacteria756Open in IMG/M
3300027379|Ga0209842_1055459All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300027750|Ga0209461_10052231All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300027821|Ga0209811_10051195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1412Open in IMG/M
3300027873|Ga0209814_10195366All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300027875|Ga0209283_10099340Not Available1903Open in IMG/M
3300027880|Ga0209481_10033672All Organisms → cellular organisms → Bacteria2329Open in IMG/M
3300027880|Ga0209481_10122603Not Available1268Open in IMG/M
3300027909|Ga0209382_11053890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium843Open in IMG/M
3300028889|Ga0247827_10876917Not Available601Open in IMG/M
3300031231|Ga0170824_128772252Not Available722Open in IMG/M
3300031545|Ga0318541_10628955Not Available600Open in IMG/M
3300031681|Ga0318572_10527370Not Available704Open in IMG/M
3300031681|Ga0318572_10728192Not Available590Open in IMG/M
3300031744|Ga0306918_10664905Not Available815Open in IMG/M
3300031893|Ga0318536_10153793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1169Open in IMG/M
3300031947|Ga0310909_11211069Not Available610Open in IMG/M
3300031954|Ga0306926_10478582All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300031954|Ga0306926_12536815Not Available561Open in IMG/M
3300032003|Ga0310897_10637557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300032013|Ga0310906_11048521All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300032013|Ga0310906_11112921Not Available572Open in IMG/M
3300032017|Ga0310899_10030731Not Available1830Open in IMG/M
3300032261|Ga0306920_101163862All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia plasticadhaerens1116Open in IMG/M
3300033289|Ga0310914_10970560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis750Open in IMG/M
3300034664|Ga0314786_002663All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae2083Open in IMG/M
3300034678|Ga0314803_077434Not Available620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil25.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.86%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.95%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.95%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025149Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10032277013300000364SoilMLPVCRTEGEGFSIPTFDMVPSDVDGFMDELQEFQSAFH
JGI25386J43895_1008457523300002912Grasslands SoilMLPACRTGGEGFAIPTFDLVPNDVEGFMEELWEFQSAFHDC
Ga0066395_1046794313300004633Tropical Forest SoilTKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP*
Ga0066388_10126665713300005332Tropical Forest SoilMLPACRTAGEGFAIPAFDVVPSDVEGFMEELWEFQATFHD
Ga0066388_10515227013300005332Tropical Forest SoilMLPACRTSGEGFAIPTFDLVPSDVEGFMEELWEFQSTFHDC
Ga0066661_1060208233300005554SoilMLPACRTEGAGFSMPTFDLVPSDVEGFMDELWEFQ
Ga0066692_1088873413300005555SoilMLPIGRTEGEGFAIPTFDVVPSDVEGFMDALWEFQSAFHDCF
Ga0058697_1060986323300005562AgaveMLPACRSQGDEFTIPTFDIVPRDVEGFMDELWEFQ
Ga0066694_1026949723300005574SoilMLPACRTAGEGFAIPTFDIVPSDVEGFLEELWEFQS
Ga0066903_10015842133300005764Tropical Forest SoilMLPACRTEGEGFTMPTLDFVPSDVEGLMDELWEFQSTFHDCFTQSGPTP*
Ga0066903_10015844953300005764Tropical Forest SoilMLPACRTAGEGFAIPTFEVVPSDVEGFIDELWEFQEAFHGPRRSD*
Ga0066903_10120382223300005764Tropical Forest SoilMLPACRTVNEGFAIPTFDLTPPNVEGFLEELWGD*
Ga0066903_10183095923300005764Tropical Forest SoilMLPACRIDGEGFAIPTFAVVPSDVEAFMDALWEFQSRFHDCDVYD*
Ga0066903_10304742513300005764Tropical Forest SoilMLPACRIGGEGFAIPTFDLVPSDVEGFMEELWAFQST
Ga0066903_10316294213300005764Tropical Forest SoilMLPTCRTEGAGFALPTFDVVPSDVGGFMDELQEFQSAFHDC
Ga0066903_10346681813300005764Tropical Forest SoilMLPACRIGGEGFAIPTFDLVPSDVEGFMEELWAFQ
Ga0066903_10729888713300005764Tropical Forest SoilMLPRCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVF
Ga0081538_1030014513300005981Tabebuia Heterophylla RhizosphereMLPACRTAGEGFAIPTFDLVPCDIEGFMDELWKFQSAFHDCFT
Ga0075422_1027438913300006196Populus RhizosphereMLPACRTAGEGFAISTFDLVPSDVEGFLEELWEFQ
Ga0066660_1146072113300006800SoilMLPACRTGGEGFAIPTFDLVPSDVEGFMEELWAFQSIFHDC
Ga0075428_10008504043300006844Populus RhizosphereMIPACRTEGDGFAIPIFDLTPRDVAGFTNELQEFQGLFHDCFSPE*
Ga0075421_10041217513300006845Populus RhizosphereMLPACRTEGDGFAIPTFDVLPSDVEGFMDELRTFQSAF
Ga0075421_10053313633300006845Populus RhizosphereMLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQ
Ga0075430_10022183823300006846Populus RhizosphereMLPACRTAGEGFAIPTCDVVPSDVEGFMEELWEFQATFHD
Ga0075425_10074655623300006854Populus RhizosphereMLPACRTAGEGFAIPTFDVVPSDVEGVLEALWEFQSTLHDCFAR
Ga0079217_1051119113300006876Agricultural SoilMLPACRTAGDGFTIPKFTLDPSDVEGFMDELHGFHTAFRDCF
Ga0075419_1031504423300006969Populus RhizosphereMLPACRIDGEGFAIPAFEVVPSDVEGCMDALWEFQSLLHDCDVYD*
Ga0075419_1091383213300006969Populus RhizosphereMLPRCRTAGEPFVIPTFDVQVSDVEGCMDELQEFQSVF
Ga0079218_1379691613300007004Agricultural SoilMLPACRTPGEGFAIPAFDVVPSDVEGFMEELWEFQ
Ga0066710_10205852523300009012Grasslands SoilMFPACRTAGDECAIPPFDLPPRDVAGVTDALQEFQGLLHDCFP
Ga0099829_1142286733300009038Vadose Zone SoilMLPACQTAGEGFVIPTFDLVPSDREGFMDALGEFQPLFRV
Ga0099827_1033881813300009090Vadose Zone SoilMLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQSV
Ga0075418_1252646013300009100Populus RhizosphereMLPVCRTAGEGFAIPTFDLVPSDVEGFMEELWEFQSAFHDCFA
Ga0114129_1221525323300009147Populus RhizosphereMLPACRTDHAGYSLPRFDFVPRAVEGFMGALGEFQSAC
Ga0111538_1204860913300009156Populus RhizosphereRTNGEGFTIPPFDLVPSDVEGFMDALWEFQSAFHDCFARSG*
Ga0114944_117186113300009691Thermal SpringsMLAACRTSGEGFAIPTFDLVPSDVEGFMEELWEFQ
Ga0126380_1000841853300010043Tropical Forest SoilMLPACRTDNEGFALPTFDLTPPDVEGFLEELWECPSAFHD
Ga0126310_1161053223300010044Serpentine SoilMLPRCRTAGEPFAIPTFDVQVSDVAGFMDELQTCQSLFHDCFA
Ga0126384_1063551913300010046Tropical Forest SoilMLPRCRTADEPFVMPPFDVQGSDVEGFIDELQEFQSLFHDCCARS
Ga0126384_1095546713300010046Tropical Forest SoilMRQKMLPACRIDGEGFAIPTFEGVPSDVEGCMDALWAFQSLLHDCDVYD*
Ga0126382_1004359143300010047Tropical Forest SoilMLPACRTVNEGFAIPTFDLTPLDVEGFLEELWGD*
Ga0126373_1013564613300010048Tropical Forest SoilMLPACRTAGEGFALPTFEVVPSDVEGFMEELWEFQSAQ*
Ga0134084_1034193513300010322Grasslands SoilMLPIGRTEGEGFAIPTFDVVPSDVEGFMDALWEFQSAFHDC
Ga0126376_1045031633300010359Tropical Forest SoilMLPACRTASGGFAIPIFDLTPLDVEGFLEELWEFQSNF
Ga0126376_1080873113300010359Tropical Forest SoilMLPACRTVNEGLAIPTFDLTPPDGEGFLEELWGD*
Ga0126376_1202825613300010359Tropical Forest SoilMLPACRTPDETFTIPMFDVLPGDVEGLVEELWEFQAAF
Ga0126372_1168134013300010360Tropical Forest SoilMLPACRTTGDEFTIPTFELTPRDVAEFTDELQEFQ
Ga0126372_1253559723300010360Tropical Forest SoilMHRHRRGRRLPAGRTAGDECVLPPFALTPRDVAGFTDELQEFQGLF
Ga0126378_1071639813300010361Tropical Forest SoilSRRPHMLPACRTKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP*
Ga0126379_1013255743300010366Tropical Forest SoilMLPACRTDGDRFTMLTFDLVPSDVDGFMDATFHE*
Ga0126379_1058777223300010366Tropical Forest SoilMLPACRTKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP*
Ga0126379_1266498923300010366Tropical Forest SoilMLPACRTAGEGFAIPTFDVVPSDVEGFMEELWEFQ
Ga0126379_1291069723300010366Tropical Forest SoilMLPACRAAAEGFTIPHFGVVPSDVTGFMEELWEFQSVFHDCFVRSES
Ga0126379_1340524313300010366Tropical Forest SoilMLPACRIASEGFAIPTFDLTPPDVEGLLEELWEFQ
Ga0126383_1080731423300010398Tropical Forest SoilMLPACRTDEVTYTIPTFDVVPSDVEGFMDELWACQAAL
Ga0126383_1209903713300010398Tropical Forest SoilMLPACRTAGEGFAIPTFEVVPSDVEGFMEELWEFQSAC
Ga0137370_1015784433300012285Vadose Zone SoilMLPACRTEGEGFAIPTFDVVPSDVEGFMDELQEFHRLLTRFGEY*
Ga0137372_1116922933300012350Vadose Zone SoilMLPVCRTIGEGLSIPTFDLAPSDVEGFMDELQEFQ
Ga0137371_1062321933300012356Vadose Zone SoilMLPACRTAGDEFAIPPFDLTPRDVAGFTDALQEFQGLCH
Ga0137361_1094365913300012362Vadose Zone SoilMLPVGRTEGEGFSIPTFDVVPSDVEGFMDELQAFQSA
Ga0134050_101254513300012407Grasslands SoilMLPRCRTAGKPFVIPTFDVQVSDVEGFMDELQEFQ
Ga0137404_1100558313300012929Vadose Zone SoilMLPACRTEGEGFAMPTFDVVPSDVEGFMDELQECQSA
Ga0126375_1092296813300012948Tropical Forest SoilMLPRCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVFHDCF
Ga0126375_1136881013300012948Tropical Forest SoilMLPVCRTAGDGFAIPPFDLTPRDVTGFTDELQEFQGLF
Ga0126375_1144124923300012948Tropical Forest SoilMLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQ
Ga0126369_1086847323300012971Tropical Forest SoilMLPACRTAGDEFAIPTFELTPRDVAEFTDALQEFQ
Ga0126369_1233287813300012971Tropical Forest SoilMLPVCRTASEGFAIPTFDLVPSDVEGFLEELWEFPSAFHDCFA
Ga0126369_1276186613300012971Tropical Forest SoilMLPACRTAGEAFAIPTFDVTPRAVEGFMEEWWEFQAAFQALN*
Ga0126369_1353372823300012971Tropical Forest SoilMLPACRTAGEGFAIPAFDVVPSAVEGFLEELWEF*
Ga0126369_1369004413300012971Tropical Forest SoilMLPHCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVFHDCF
Ga0182000_1060343523300014487SoilMLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQSVFH
Ga0132257_10201052123300015373Arabidopsis RhizosphereMLPACRTDNEGFAIPTFDLTPPDVEGFLETLWEFQSAFHDCFP
Ga0182033_1083965613300016319SoilMLPRCRTAGEPFVIPPFDVQVSDVEGFMDEVQTFQSVFHDCF
Ga0182040_1174429413300016387SoilMLPACRTNGEGFTIPTFDLVPSDVEGFMEELWAFQ
Ga0184629_1066233913300018084Groundwater SedimentMLPACRTDGEGFTIPTFDVVSSDVEGFMDELWEFQSAFHDC
Ga0066662_1169755913300018468Grasslands SoilMLPACRTAGDECAISPFDLPPRDVAGVTDALQEFQGLLHD
Ga0126371_1034918623300021560Tropical Forest SoilMLPACRTGGEGFAIPTFDLAPSDVEGFMEELWEFQS
Ga0209827_1012884323300025149Thermal SpringsMLPACRTADEGFSIPTFDVVPRDVEGFMDALQECPSAFHDLIG
Ga0207684_1087481813300025910Corn, Switchgrass And Miscanthus RhizosphereMLPACRTDGEGFSIPTFDVVPSDVEGFMEALWEFQST
Ga0209842_105545923300027379Groundwater SandIIRRQRMLPIGRTEGEGCAIPTFDVVPSDVEGFMDALWEFQ
Ga0209461_1005223113300027750AgaveMLPRCRTVGEPFVIPPFDVQVSDVEGFMDELQEFQSVF
Ga0209811_1005119513300027821Surface SoilMLPACRTAGNGFAIPTFDLTPGDVAGFIDELQEFQGL
Ga0209814_1019536623300027873Populus RhizosphereMLPACRTDHEGFTIPTFDLVPSDVEGFMAELWEFQSAFHDCFT
Ga0209283_1009934013300027875Vadose Zone SoilMLPACRTEGEGFAIPTFDVVPSDVEGFMDALQEFQ
Ga0209481_1003367243300027880Populus RhizosphereMIPACRTEGDGFAIPIFDLTPRDVAGFTNELQEFQGLFHDCFSPE
Ga0209481_1012260333300027880Populus RhizosphereMLPACRIDGEGFAIPAFEVVPSDVEGCMDALWEFQSLLHDCDVYD
Ga0209382_1105389013300027909Populus RhizosphereMLPACRTAGEGFAISTFDLVPSDVEGFLEALWEFQ
Ga0247827_1087691713300028889SoilMLPACRTEGAGFSLPPFDLVPSDVEGFMDELWEFQSTFHDCCARSEPRL
Ga0170824_12877225223300031231Forest SoilPACRTDHEGFTIPTFDRVPRAVEGFMDALWECQSALHDCCARSEPRVHFFD
Ga0318541_1062895523300031545SoilMLPRCRTAGEPFVMPTFAVQVSDVEGFMDELQAFQ
Ga0318572_1052737023300031681SoilMLPACRTAGEGLALPTFEVVPSDVAGFMEELWEFQSAFHD
Ga0318572_1072819213300031681SoilMSPACRIDGGGFTIPTFDLVPRDVEGFMDELWEFQAAVHDCFTRSEPRAHF
Ga0306918_1066490513300031744SoilMLPARRTSGEGFTIPTFDLVPSDVEGFMDALWEFQSAFHDCFAR
Ga0318536_1015379313300031893SoilRTAGEPFVIPPFDVQVSDVEGFMDELQTFQSVFHD
Ga0310909_1121106913300031947SoilMLPARRTSGEGFTIPTFDLVPSDVEGFMDALWEFQ
Ga0306926_1047858233300031954SoilMSPACRIDGGGFTIPTFDLVPRDVEGFMDELWEFQAAVHD
Ga0306926_1253681523300031954SoilMLPACRTASEGFAIATFDLVPSDVEGFLEELWEFPSAFHDCFAPQ
Ga0310897_1063755713300032003SoilMLPACRTGGEGFAIPTFDLVPNDVEGFMEELWEFQSAFHDCFA
Ga0310906_1104852113300032013SoilMLPACRTAGEGFAIPTFDVVPSDVEGFLEERWELQSTF
Ga0310906_1111292113300032013SoilMLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQSVFHD
Ga0310899_1003073123300032017SoilMLPACRTAGESFAIPTFDVVPSDVEGFMEELWEFQ
Ga0306920_10116386213300032261SoilMLPACRTDEATYTIPTFDIVPGDVEGFMDELWEFQ
Ga0310914_1097056013300033289SoilMLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQG
Ga0314786_002663_14_1363300034664SoilMLPACRTNGEGFTIPTFDIVPSDVEGFMDELWEFQSAFHD
Ga0314803_077434_504_6203300034678SoilMLPACRTAGEGIAIPTFDLAPRDVEGFMEELWEFQAAFH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.