Basic Information | |
---|---|
Family ID | F095584 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 51 residues |
Representative Sequence | MPISQERELEIEQELAAIVRELERRPLMEKRGPKKPEQAVQLPVGTILLDE |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.14 % |
% of genes near scaffold ends (potentially truncated) | 31.43 % |
% of genes from short scaffolds (< 2000 bps) | 92.38 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.095 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.381 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.048 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.762 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.32% β-sheet: 0.00% Coil/Unstructured: 74.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF01569 | PAP2 | 21.90 |
PF00072 | Response_reg | 4.76 |
PF07883 | Cupin_2 | 1.90 |
PF04386 | SspB | 1.90 |
PF07885 | Ion_trans_2 | 1.90 |
PF09123 | DUF1931 | 0.95 |
PF07045 | DUF1330 | 0.95 |
PF00230 | MIP | 0.95 |
PF03703 | bPH_2 | 0.95 |
PF13431 | TPR_17 | 0.95 |
PF07784 | DUF1622 | 0.95 |
PF00528 | BPD_transp_1 | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG2969 | Stringent starvation protein B, binds SsrA peptide | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.95 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.95 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.95 |
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.10 % |
Unclassified | root | N/A | 21.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_115146291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1253 | 797 | Open in IMG/M |
3300002076|JGI24749J21850_1040829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 679 | Open in IMG/M |
3300002886|JGI25612J43240_1016057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1107 | Open in IMG/M |
3300005168|Ga0066809_10144618 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005168|Ga0066809_10152624 | Not Available | 600 | Open in IMG/M |
3300005335|Ga0070666_10705982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300005336|Ga0070680_100235088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1548 | Open in IMG/M |
3300005337|Ga0070682_100138601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1655 | Open in IMG/M |
3300005341|Ga0070691_10267196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 923 | Open in IMG/M |
3300005355|Ga0070671_100448469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1107 | Open in IMG/M |
3300005438|Ga0070701_10028153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2761 | Open in IMG/M |
3300005438|Ga0070701_10389296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 881 | Open in IMG/M |
3300005441|Ga0070700_100705894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
3300005444|Ga0070694_100922382 | Not Available | 722 | Open in IMG/M |
3300005456|Ga0070678_100884317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 816 | Open in IMG/M |
3300005466|Ga0070685_10507040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 855 | Open in IMG/M |
3300005533|Ga0070734_10290565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 62-47 | 935 | Open in IMG/M |
3300005548|Ga0070665_100568519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1146 | Open in IMG/M |
3300005548|Ga0070665_101979835 | Not Available | 588 | Open in IMG/M |
3300005617|Ga0068859_101433747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 762 | Open in IMG/M |
3300005618|Ga0068864_102434088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 530 | Open in IMG/M |
3300005719|Ga0068861_101604147 | Not Available | 641 | Open in IMG/M |
3300005719|Ga0068861_102231772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300006028|Ga0070717_10983529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 768 | Open in IMG/M |
3300006038|Ga0075365_11290424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 513 | Open in IMG/M |
3300006042|Ga0075368_10481641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 552 | Open in IMG/M |
3300006353|Ga0075370_10281890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 987 | Open in IMG/M |
3300006358|Ga0068871_101026746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 769 | Open in IMG/M |
3300006852|Ga0075433_11430557 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300007788|Ga0099795_10490229 | Not Available | 572 | Open in IMG/M |
3300009092|Ga0105250_10073928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1378 | Open in IMG/M |
3300009094|Ga0111539_10287047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1915 | Open in IMG/M |
3300009094|Ga0111539_12559015 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300009098|Ga0105245_10358640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1446 | Open in IMG/M |
3300009100|Ga0075418_10350434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1576 | Open in IMG/M |
3300009101|Ga0105247_11122528 | Not Available | 621 | Open in IMG/M |
3300009148|Ga0105243_10172394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri | 1875 | Open in IMG/M |
3300009162|Ga0075423_12033539 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300009174|Ga0105241_11515671 | Not Available | 646 | Open in IMG/M |
3300009176|Ga0105242_11408595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 725 | Open in IMG/M |
3300009551|Ga0105238_10644075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1069 | Open in IMG/M |
3300009553|Ga0105249_10433854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1350 | Open in IMG/M |
3300009789|Ga0126307_10072610 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
3300010159|Ga0099796_10395591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
3300010166|Ga0126306_10079910 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300010373|Ga0134128_10306593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1777 | Open in IMG/M |
3300010396|Ga0134126_11943932 | Not Available | 644 | Open in IMG/M |
3300010397|Ga0134124_11031628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 836 | Open in IMG/M |
3300010400|Ga0134122_10775981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 911 | Open in IMG/M |
3300011119|Ga0105246_11024616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 749 | Open in IMG/M |
3300011120|Ga0150983_11647649 | Not Available | 541 | Open in IMG/M |
3300011120|Ga0150983_16615372 | Not Available | 540 | Open in IMG/M |
3300012198|Ga0137364_10922043 | Not Available | 661 | Open in IMG/M |
3300012212|Ga0150985_117430735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1061 | Open in IMG/M |
3300012494|Ga0157341_1050051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 509 | Open in IMG/M |
3300012912|Ga0157306_10141983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 749 | Open in IMG/M |
3300012922|Ga0137394_10161902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1906 | Open in IMG/M |
3300012957|Ga0164303_10968021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
3300012958|Ga0164299_10825902 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012988|Ga0164306_11079313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 666 | Open in IMG/M |
3300013308|Ga0157375_10353647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1635 | Open in IMG/M |
3300013308|Ga0157375_10506480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 1371 | Open in IMG/M |
3300013308|Ga0157375_11148927 | Not Available | 910 | Open in IMG/M |
3300014325|Ga0163163_13314755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 502 | Open in IMG/M |
3300015264|Ga0137403_10090755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3073 | Open in IMG/M |
3300015372|Ga0132256_101828435 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300015374|Ga0132255_105102459 | Not Available | 556 | Open in IMG/M |
3300017965|Ga0190266_11135101 | Not Available | 536 | Open in IMG/M |
3300018072|Ga0184635_10101177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1140 | Open in IMG/M |
3300018072|Ga0184635_10226610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 743 | Open in IMG/M |
3300018073|Ga0184624_10423062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 588 | Open in IMG/M |
3300018081|Ga0184625_10084470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1627 | Open in IMG/M |
3300018469|Ga0190270_12525210 | Not Available | 576 | Open in IMG/M |
3300018476|Ga0190274_10032148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 3598 | Open in IMG/M |
3300018476|Ga0190274_11334886 | Not Available | 805 | Open in IMG/M |
3300019789|Ga0137408_1048700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 692 | Open in IMG/M |
3300021078|Ga0210381_10024577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1639 | Open in IMG/M |
3300021478|Ga0210402_10157628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 2070 | Open in IMG/M |
3300021478|Ga0210402_10639286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia humisilvae | 985 | Open in IMG/M |
3300025315|Ga0207697_10086934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1322 | Open in IMG/M |
3300025893|Ga0207682_10202035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 914 | Open in IMG/M |
3300025901|Ga0207688_10654279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 663 | Open in IMG/M |
3300025917|Ga0207660_10426242 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300025924|Ga0207694_11188015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangzhouense | 645 | Open in IMG/M |
3300025927|Ga0207687_10712139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 852 | Open in IMG/M |
3300025941|Ga0207711_10756760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 905 | Open in IMG/M |
3300025942|Ga0207689_11692876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 524 | Open in IMG/M |
3300025945|Ga0207679_12041710 | Not Available | 521 | Open in IMG/M |
3300026088|Ga0207641_11010006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 829 | Open in IMG/M |
3300026285|Ga0209438_1023991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2036 | Open in IMG/M |
3300026340|Ga0257162_1017632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 851 | Open in IMG/M |
3300027907|Ga0207428_10191372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1542 | Open in IMG/M |
3300027908|Ga0209006_10439423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1094 | Open in IMG/M |
3300028379|Ga0268266_11204876 | Not Available | 732 | Open in IMG/M |
3300028379|Ga0268266_11466341 | Not Available | 658 | Open in IMG/M |
3300028802|Ga0307503_10272655 | Not Available | 837 | Open in IMG/M |
3300028819|Ga0307296_10197417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1092 | Open in IMG/M |
3300031122|Ga0170822_13003591 | Not Available | 789 | Open in IMG/M |
3300031128|Ga0170823_10800905 | Not Available | 687 | Open in IMG/M |
3300031170|Ga0307498_10012816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1732 | Open in IMG/M |
3300031708|Ga0310686_103908803 | Not Available | 542 | Open in IMG/M |
3300031708|Ga0310686_114335350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2310 | Open in IMG/M |
3300031740|Ga0307468_102280458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
3300032012|Ga0310902_10212383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
3300033180|Ga0307510_10600900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 552 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.90% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.95% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1151462911 | 3300000956 | Soil | MPISQERELEIEQELAAIVRELERRPPVEKRGPKKPEQAVQLPVGTILLDE* |
JGI24749J21850_10408292 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | WPQTKERHMPISQERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
JGI25612J43240_10160573 | 3300002886 | Grasslands Soil | MPISQERELGIEQELAAIVRELERRRSMEKRGPKKPEQAVQLPMGTILLDE* |
Ga0066809_101446182 | 3300005168 | Soil | MPISQERELEIEQELAVIVRELERRPPMEKRGLKKPEQTLQLPVGTILLDL* |
Ga0066809_101526241 | 3300005168 | Soil | MPISQQPELELEQELAAIVRELERRRPMEKRGPKKPEQALQLPAGTILLDE* |
Ga0070666_107059821 | 3300005335 | Switchgrass Rhizosphere | MPISQERELEIEQELAAILRELERRPPMENGDPKSLNKRQIPKGTILLDE* |
Ga0070680_1002350883 | 3300005336 | Corn Rhizosphere | WPQTKERHMPISQERELEIELELAAIVRELERRPPTEKRGPKKPEQAVQFPVGTILLDE* |
Ga0070682_1001386011 | 3300005337 | Corn Rhizosphere | MPISQERELEIELELAAIVRELERRPPTEKRGPKKPEQAVQFPVGTILLDE* |
Ga0070691_102671962 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISQERELELEQELAAIVRKLERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0070671_1004484692 | 3300005355 | Switchgrass Rhizosphere | MPINQKREVDIEQELAAIVRELERCRPMEKRGSKKPEQAVQIPMGTILLDG* |
Ga0070701_100281535 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISQERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0070701_103892961 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLTQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE* |
Ga0070700_1007058942 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISQERELEIEQELAAILRELERRPPMEKRGSQKPETVQVPVGTILLDE* |
Ga0070694_1009223821 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIIHERELEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTILLDG* |
Ga0070678_1008843171 | 3300005456 | Miscanthus Rhizosphere | MPISQERELEIEQELAAIVRKLERRPSIEKRGPKKPEAVQVPKGTILLDE* |
Ga0070685_105070402 | 3300005466 | Switchgrass Rhizosphere | MPISQERELELDQELAAIVRKLERRPPMEKRGSQKPETVQVPVGTILLDE* |
Ga0070734_102905652 | 3300005533 | Surface Soil | VPISEKRELEIEHELAAIIRELDRRPPVEKPGPKKPEQSVQCPVGTILIDE* |
Ga0070665_1005685193 | 3300005548 | Switchgrass Rhizosphere | QKAGTQTKERHMPINQKREVDIEQELAAIVRELERCRPMEKRGSKKPEQAVQIPMGTILLDG* |
Ga0070665_1019798352 | 3300005548 | Switchgrass Rhizosphere | MPISQERELELEQELAAIVRKLERRPSVEKRGPKKPEAIQVPVGTILLDE* |
Ga0068859_1014337471 | 3300005617 | Switchgrass Rhizosphere | MPIIHERELEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTILLD |
Ga0068864_1024340882 | 3300005618 | Switchgrass Rhizosphere | IEQELAAIVRELERCRPMEKRGSKKPEQAVQIPMGTILLDG* |
Ga0068861_1016041471 | 3300005719 | Switchgrass Rhizosphere | MPISQERELELEQELAAIVSKLERRPPIEKRAPKKPEAVQVPKGTILI |
Ga0068861_1022317721 | 3300005719 | Switchgrass Rhizosphere | LELEQELAAIVRKLERRPSVEKRGPKKPEAIQVPVGTILLDE* |
Ga0070717_109835292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISQERELEIELELAAIVRELERRPPTEKRGPKKPEQAVQFPVGTILLD |
Ga0075365_112904241 | 3300006038 | Populus Endosphere | MPITQERELEIEQELAAIVRELERRGPMDRQRSKTPEPAVQLPVGT |
Ga0075368_104816411 | 3300006042 | Populus Endosphere | MPITQERELEIEQELAAIVRELERRGPMDRQRSKTPEPAVQLPVGTILLDE* |
Ga0075370_102818902 | 3300006353 | Populus Endosphere | LEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE* |
Ga0068871_1010267462 | 3300006358 | Miscanthus Rhizosphere | LEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0075433_114305572 | 3300006852 | Populus Rhizosphere | MPISQERELELEQELAAIVRKLERRPPMEERGPKKPGTVQVPVGTILFDE* |
Ga0099795_104902292 | 3300007788 | Vadose Zone Soil | MPISQERELGIEQELAAIVRELERRRSMEKRGLKKPEQAVQLPVGTILLDE |
Ga0105250_100739281 | 3300009092 | Switchgrass Rhizosphere | MPISQERELELEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0111539_102870474 | 3300009094 | Populus Rhizosphere | MPLTQERVLEIEQELAAIVRELERRRPMDKQRSNKPEPEVQLPVGTILLDE* |
Ga0111539_125590152 | 3300009094 | Populus Rhizosphere | WPQTKERHMPISQERELELEQELAAIVRKLERRPPMEERGPKKPGTVQVPVGTILFDE* |
Ga0105245_103586402 | 3300009098 | Miscanthus Rhizosphere | MPITQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE* |
Ga0075418_103504342 | 3300009100 | Populus Rhizosphere | MPISQERELELEQELAAIVRKLERRPPMEKRGSKKPETVQVPVGTILFDE* |
Ga0105247_111225281 | 3300009101 | Switchgrass Rhizosphere | MPISQKREVDIEQELAAIVRELERCRPMEKRGPKKPEQAVQIPMGTILLDG* |
Ga0105243_101723941 | 3300009148 | Miscanthus Rhizosphere | QVRDLEIEQELAAILRELERRPPMEKRGPKKPEQTVQIPKGTILFDE* |
Ga0075423_120335392 | 3300009162 | Populus Rhizosphere | MPISQERELEFEQELAALVRKLERRPPMEERGPKKPGTVQVPVGTILFDE* |
Ga0105241_115156711 | 3300009174 | Corn Rhizosphere | MPIIHERELEIEQELAAIMRELERHPPMEKGGPKKPETVQVPMGTILLDE* |
Ga0105242_114085951 | 3300009176 | Miscanthus Rhizosphere | LDYDPQYKGRGRKKERHMPISQKRELNIEQELAAIVRELERCRTVEKRGPKKPEQAVQIPMGTILLD |
Ga0105238_106440752 | 3300009551 | Corn Rhizosphere | ERHMPIIHERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0105249_104338542 | 3300009553 | Switchgrass Rhizosphere | MPISQERELELDQELAAIVRKLERRPPMEKRGSQKPETVQVPVGRILLDE* |
Ga0126307_100726105 | 3300009789 | Serpentine Soil | MPISQERELEIEQELAAIVRELERGPPMEKRGPKKPEQAVQVPAGTILLDE* |
Ga0099796_103955911 | 3300010159 | Vadose Zone Soil | MPISQERELGIEQELAAIVRELERRRSMEKRGPKKPEQAVQLPVGTILLDE* |
Ga0126306_100799101 | 3300010166 | Serpentine Soil | MPISQERELEMEQELAAIVRELERGPPMEKRGPKKPEQAVQVPAGTILLDE* |
Ga0134128_103065932 | 3300010373 | Terrestrial Soil | MPISQERELEIEQELAAIVRELERRPPTEKRGPKKPEQAVQFPVGTILLDE* |
Ga0134126_119439321 | 3300010396 | Terrestrial Soil | MAVAANKERHMPISQKRELEIEQELAAVVRELERLRLMERRGPRKPEQAVQLPLGTILLDE* |
Ga0134124_110316281 | 3300010397 | Terrestrial Soil | MPISQERELEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTILLDG* |
Ga0134122_107759811 | 3300010400 | Terrestrial Soil | MPIRQERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0105246_110246162 | 3300011119 | Miscanthus Rhizosphere | MPIIHERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE* |
Ga0150983_116476491 | 3300011120 | Forest Soil | KKERHMPISQERELEIEQELAAIVRELERRPPMEKRGPKKPEQALQLPVGTILLDG* |
Ga0150983_166153721 | 3300011120 | Forest Soil | KKERHMPISQERELEIEQELAAIVRELERRPPMETRGPKKPEQALQLPKGTILLDG* |
Ga0137364_109220431 | 3300012198 | Vadose Zone Soil | MPISQERELDIEQELAAIVRELERRPPMEKRGPKKPEQAIQLPVGTILLDG* |
Ga0150985_1174307352 | 3300012212 | Avena Fatua Rhizosphere | MPMSQKPELDIEQELAAIVRELERSRPSEKGGPKTPDRAVQLPAGQDPT* |
Ga0157341_10500511 | 3300012494 | Arabidopsis Rhizosphere | KERHMPISQERELEIEQELAAIVRELERRPPTEKRGPKEPEQAVQFPVGTILLDE* |
Ga0157306_101419832 | 3300012912 | Soil | MPLTQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPAVQLPAGTILLDE* |
Ga0137394_101619022 | 3300012922 | Vadose Zone Soil | MPISQERELEIEQELAAIVRELERRPLMEKRGPKKPEQAVQLPVGTILLDE* |
Ga0164303_109680211 | 3300012957 | Soil | MPISQERELESEQELAAILRELERRPPMEKRGPKKPEQAVQLPVGTILLDE* |
Ga0164299_108259022 | 3300012958 | Soil | MPISQERELEIEQELAAILRELERRPPMEKRGPKKPEQAVQVPPGTILLDE* |
Ga0164306_110793132 | 3300012988 | Soil | MPISQERELEIEQELAALVRELEHHLSMEKRGPKKPEHTVQIPVGTILLDE* |
Ga0157375_103536471 | 3300013308 | Miscanthus Rhizosphere | MPISQERELELEQELAAIVSKLERRPPIEKRAPKKPEAVQVPKGTILINE* |
Ga0157375_105064801 | 3300013308 | Miscanthus Rhizosphere | MPIIHERELEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTVLLDG* |
Ga0157375_111489272 | 3300013308 | Miscanthus Rhizosphere | MPISQKREVDIEQELAAIVRELERCRPMEKRGSKKPEQAVQIPMGTILLDG* |
Ga0163163_133147552 | 3300014325 | Switchgrass Rhizosphere | MPISQKRELDIEQELASIVRELERCRQVEKRGPKKPEQAVQIPMGTILLDG* |
Ga0137403_100907554 | 3300015264 | Vadose Zone Soil | MPVSQERELEIEQELAAIVRELERRPLMEKRGPKKPEQAVQLPVGTILLDE* |
Ga0132256_1018284353 | 3300015372 | Arabidopsis Rhizosphere | MPISQERELELDQELAAIVRKLERRPPMEERGPKKPETVQVPVGTILFDE* |
Ga0132255_1051024592 | 3300015374 | Arabidopsis Rhizosphere | RHMPISQERELEIEQEIAAIVCELERRPPMENGDPNCLNKLTVGAILLDE* |
Ga0190266_111351011 | 3300017965 | Soil | MPISQERELELEQELAAIVSKLERRPPIEKRAPKKPEAVQVPKGTILLDE |
Ga0184635_101011772 | 3300018072 | Groundwater Sediment | MPISQERELEIEQELAAIVRELERGPQMEKRGPKKPEQAVQLPVGTILLD |
Ga0184635_102266101 | 3300018072 | Groundwater Sediment | MPISQERELELEQELAAIVRKLERRQSMEKREPKKPEQAVQLPVGTILLDE |
Ga0184624_104230621 | 3300018073 | Groundwater Sediment | KERHMPISQERELEIEQELAAIVRELERGPQMEKRGPKKPEQALQLPVGTILLDE |
Ga0184625_100844703 | 3300018081 | Groundwater Sediment | MPISQERELEIEQELAAIVRELERGPQMEKRGPKKPEQAVQLPVGTILLDE |
Ga0190270_125252101 | 3300018469 | Soil | MPISQERELELEQELAAIVRKLERRPSVEKRWPKKPEAIQVPVGTVLLDE |
Ga0190274_100321481 | 3300018476 | Soil | MPLTQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPAVQLPAGTILLDE |
Ga0190274_113348861 | 3300018476 | Soil | MPISQERELELEQELAAIVRKLERRPSVEKRGPKKPEAIQVPVGTILLDE |
Ga0137408_10487003 | 3300019789 | Vadose Zone Soil | MPISQERELEIEQELAAIVRELERRPLMEKRGPKKPEQAVQLPVGTILLDE |
Ga0210381_100245771 | 3300021078 | Groundwater Sediment | MPISQERELEIEQELAAIVRELERRPSMEKRGPKKPEQAVQLPAGTILLDE |
Ga0210402_101576283 | 3300021478 | Soil | MPISQKRELEIEQELAAIVRELERRPPMEKRGPKKPEEALQLPVGTVLLDL |
Ga0210402_106392861 | 3300021478 | Soil | ELEIEQELAAIVRELERRPPMEKRGPKKPEQALQLPVGTILLDL |
Ga0207697_100869341 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLTQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE |
Ga0207682_102020351 | 3300025893 | Miscanthus Rhizosphere | MPISQERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE |
Ga0207688_106542792 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | QKAGTQTKERHMPISQKREVDIEQELAAIVRELERCRPMEKRGSKKPEQAVQIPMGTILLDG |
Ga0207660_104262421 | 3300025917 | Corn Rhizosphere | QWPQTKERHMPISQERELEIELELAAIVRELERRPPTEKRGPKKPEQAVQFPVGTILLDE |
Ga0207694_111880152 | 3300025924 | Corn Rhizosphere | MPISQERELELDQELAAIVRKLERRPPMEKRGSQKPETVQVPVGTILLDE |
Ga0207687_107121392 | 3300025927 | Miscanthus Rhizosphere | RHMPLTQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE |
Ga0207711_107567602 | 3300025941 | Switchgrass Rhizosphere | RELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE |
Ga0207689_116928761 | 3300025942 | Miscanthus Rhizosphere | MPITQERVLEIEQELAAIVRELERRRPMDKQRSKKPEPEVQLPVGTILLDE |
Ga0207679_120417101 | 3300025945 | Corn Rhizosphere | MPISQERELEIEQELAAILRELERRPPMEKRGSQKPETVQVPVGTILLDE |
Ga0207641_110100061 | 3300026088 | Switchgrass Rhizosphere | MPISQERELEIEQELAAILRELERCPPMEKRGPKKPEQALQLPVGTILLDE |
Ga0209438_10239913 | 3300026285 | Grasslands Soil | MPISQERELGIEQELAAIVRELERRRSMEKRGPKKPEQAVQLPMGTILLDE |
Ga0257162_10176321 | 3300026340 | Soil | MPISQERELGIEQELAAIVRELERRRSMEKRGPKKPEQAVQLPVGTILLDE |
Ga0207428_101913721 | 3300027907 | Populus Rhizosphere | ERVLEIEQELAAIVRELERRRPMDKQRSNKPEPEVQLPVGTILLDE |
Ga0209006_104394232 | 3300027908 | Forest Soil | MPISRERELEIEQELAAIVRELEGRRRMEKRGPKKPEQALQPPMGTILLDG |
Ga0268266_112048761 | 3300028379 | Switchgrass Rhizosphere | MPIIHERELEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTI |
Ga0268266_114663411 | 3300028379 | Switchgrass Rhizosphere | MPISQERELELEQELAAIVSKLERRPPIEKRAPKKPEAVQVPKGTILIDE |
Ga0307503_102726551 | 3300028802 | Soil | LEIEQELAAIMRELERHPPMEKRGPKKLEQAVQVPVGTILLDG |
Ga0307296_101974172 | 3300028819 | Soil | MPISQERELEIEQELAAIVRELERRPSMEHAVQLPAGTILLDE |
Ga0170822_130035912 | 3300031122 | Forest Soil | MPISQERELDIEQELAAIVRELERRPPMEKRGRPKKPEQALQLPVGTILLDG |
Ga0170823_108009052 | 3300031128 | Forest Soil | MPISQERGLEIEQELAAIVRELERRPPMEKRGRPKKPEQALQLPVGTILLDG |
Ga0307498_100128163 | 3300031170 | Soil | MPISQERELEMEQELAAIVRKLERRPPMEKRGPKKPEQAVQLPVGTILLDE |
Ga0310686_1039088031 | 3300031708 | Soil | MAISQERELELEQELAAIVRKLERHPPMEKRGPKKPETVQVPL |
Ga0310686_1143353507 | 3300031708 | Soil | WAIKERHMPISRERELEIEQELAAIVRELERRRRMEKRGPQKPEQALQPPMGTILLDG |
Ga0307468_1022804582 | 3300031740 | Hardwood Forest Soil | MAISQERELEIEQELAAILRELERRPPMEKRGPKKPEQALQLPVGTILLDE |
Ga0310902_102123833 | 3300032012 | Soil | MPISQERELELEQELAAIVRKLERRPPMEKRGSQKPETVQVPVGTILLDE |
Ga0307510_106009002 | 3300033180 | Ectomycorrhiza | KCPWPQTKERHMPISQERELGIEQELAAIVRELERRRSMEKRGPKKPEQAVQLPVGTILLDE |
⦗Top⦘ |