NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095537

Metagenome Family F095537

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095537
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 46 residues
Representative Sequence LLQVELLHKGGLAGGGPAAHADGVLKSVLEYVDQFSTRIRDANK
Number of Associated Samples 96
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.95 %
% of genes from short scaffolds (< 2000 bps) 0.95 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.429 % of family members)
Environment Ontology (ENVO) Unclassified
(40.952 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.381 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.83%    β-sheet: 0.00%    Coil/Unstructured: 54.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00005ABC_tran 4.76
PF02566OsmC 2.86
PF13432TPR_16 1.90
PF07635PSCyt1 1.90
PF13699DUF4157 1.90
PF02371Transposase_20 1.90
PF08309LVIVD 1.90
PF05163DinB 1.90
PF07995GSDH 1.90
PF14534DUF4440 1.90
PF04519Bactofilin 1.90
PF13442Cytochrome_CBB3 1.90
PF00582Usp 0.95
PF01436NHL 0.95
PF13474SnoaL_3 0.95
PF13278Obsolete Pfam Family 0.95
PF00903Glyoxalase 0.95
PF01966HD 0.95
PF13620CarboxypepD_reg 0.95
PF01453B_lectin 0.95
PF14849YidC_periplas 0.95
PF13714PEP_mutase 0.95
PF01186Lysyl_oxidase 0.95
PF07969Amidohydro_3 0.95
PF13304AAA_21 0.95
PF02887PK_C 0.95
PF05336rhaM 0.95
PF12681Glyoxalase_2 0.95
PF00753Lactamase_B 0.95
PF07637PSD5 0.95
PF12867DinB_2 0.95
PF12833HTH_18 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.86
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.86
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 1.90
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.90
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 1.90
COG3547TransposaseMobilome: prophages, transposons [X] 1.90
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 1.90
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.95
COG3254L-rhamnose mutarotaseCell wall/membrane/envelope biogenesis [M] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300033487|Ga0316630_11379816Not Available632Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.86%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.95%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.95%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1094162523300000363SoilGGLAGGAPAAHAEGVLKSVLEYVDQFSTRIRDANK*
ICChiseqgaiiFebDRAFT_1345498513300000363SoilAQLTHTVSPVLLQVELLHKGGLAGGAPAAHADDVLKNVLEYVGQFSTRIRDANK*
JGI11643J12802_1044001013300000890SoilSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK*
JGI10216J12902_11053787213300000956SoilAAPLAHTSAPVELQVELLRKGGLAGGAPAQNGDAVTKNVLEYVDQFAARIKNANK*
JGI24743J22301_1006183313300001991Corn, Switchgrass And Miscanthus RhizosphereYQDKPVLVQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK*
JGI24035J26624_102462423300002126Corn, Switchgrass And Miscanthus RhizosphereVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK*
JGI24036J26619_1003005313300002128Corn, Switchgrass And Miscanthus RhizosphereVQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK*
Ga0065715_1068888413300005293Miscanthus RhizosphereVLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK*
Ga0065707_1024376723300005295Switchgrass RhizosphereVLVQVSLLHKGGIAGGAPTPHAEGVLRGVQESVDQFSTRIRDANK*
Ga0070690_10021484423300005330Switchgrass RhizosphereLQVELLHKGGLAGGGPAQNGDTVTKNVLEYVDQVTTRIKNANK*
Ga0070690_10026466113300005330Switchgrass RhizospherePVLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK*
Ga0068869_10172463913300005334Miscanthus RhizosphereELLHKGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK*
Ga0070687_10008534113300005343Switchgrass RhizospherePLAHTAAPVELQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK*
Ga0070671_10087300913300005355Switchgrass RhizosphereLQVELLHKGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK*
Ga0070708_10133794513300005445Corn, Switchgrass And Miscanthus RhizosphereSYQETPVLVQVSLLHKGGIAGGASATHAEGVLRGVQEYVDQFSTRIRDVNK*
Ga0070698_10108949223300005471Corn, Switchgrass And Miscanthus RhizospherePVLVQVSLLHKGGIAGGASSVHAEGVLRGVQEFVDQFSTRIRDANK*
Ga0070697_10206577023300005536Corn, Switchgrass And Miscanthus RhizosphereTAKLSYQETPVLVQVSLLHKGGIAGGASATHAAGVLRGVQEYVDQFSTRIRDANK*
Ga0070665_10113360113300005548Switchgrass RhizosphereLHKGGIAGGASAANADGVTRGLLDYIDGFATRIKDANKPH*
Ga0070704_10165746313300005549Corn, Switchgrass And Miscanthus RhizosphereETPVLVQVSLLHKGGIGGGSPAAHAAEVLRSVQEYVGQFATRIRDANK*
Ga0066698_1099930313300005558SoilYQDTPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK*
Ga0070664_10175231723300005564Corn RhizosphereGGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK*
Ga0068857_10239455313300005577Corn RhizosphereVLVEVSLLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ*
Ga0068859_10012017623300005617Switchgrass RhizosphereKLPHTESPVLLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK*
Ga0068870_1142472513300005840Miscanthus RhizosphereELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK*
Ga0068863_10174825813300005841Switchgrass RhizosphereLQVELLHKGGLAGGAPAQNGDTVTKNVLDYVDQFAARIKNANK*
Ga0075294_103378123300005881Rice Paddy SoilVLLQVELLHRGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK*
Ga0066656_1049164623300006034SoilAGGAAAAHAEAVLRGVQEYIDQFSTRIRDANKKL*
Ga0068871_10215751913300006358Miscanthus RhizosphereLLVQVSLLHKGGIAGGAPASHAEGVLRGVKQYVDQFATRIRDANK*
Ga0079222_1192995413300006755Agricultural SoilLLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ*
Ga0066665_1089273713300006796SoilLLHKGGIAGGAPAAHADGVVKSVLEYVDQFSARIRNAAK*
Ga0079220_1113183413300006806Agricultural SoilLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ*
Ga0111539_1178021423300009094Populus RhizosphereSAPVELQVELLHKGGLAGGAPAQNGDAVTKNVLEYVDQFATRIKNANK*
Ga0066709_10082313723300009137Grasslands SoilLLHKGGLAGGAAAAHAGSVLRGVQEYVDQFSTRIRDANKKL*
Ga0066709_10286651113300009137Grasslands SoilVLVLVSLLHKGGLAGGAPAAHAEGVLRGVQEYVDQFSTRIRDANK*
Ga0105243_1149929123300009148Miscanthus RhizosphereLLHKGGIAGGAPASHAESVLRGVKQYVDQFATRIRDANK*
Ga0111538_1165990333300009156Populus RhizosphereVAPLGHTASAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK*
Ga0134127_1146546423300010399Terrestrial SoilSPVLLQVELLHKGGLAGGAPAAHAEGVLKSVLEYVDQFSTRIRDANK*
Ga0105246_1212836823300011119Miscanthus RhizosphereSSPVELQVELIHKGGLAGGSPAVHADAVTKNVLELVDQFATRVRDANK*
Ga0137393_1120581723300011271Vadose Zone SoilKLAYQEAPVLVQVSLLHKGGLAGGASAVHAEAVLRGVQEYVDQFSARVRDANK*
Ga0137365_1007765713300012201Vadose Zone SoilDTPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK*
Ga0137376_1083632123300012208Vadose Zone SoilLSHTASPVLLQVELLHKGGIAGGAPAAHADGVVKSVLEYVDQFSARIRNAAK*
Ga0137371_1053947423300012356Vadose Zone SoilHMGGIAGVASAAHAAGVLRGVQEYVDQFSTRIRDANK*
Ga0157355_104591413300012493Unplanted SoilPHTSSPVLLQAELLHRGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK*
Ga0157284_1003312413300012893SoilVVSAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK*
Ga0157296_1001780533300012905SoilSAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK*
Ga0137359_1150501423300012923Vadose Zone SoilPVLVQVSLLHKGGIAGSASASHAEAVLRGVQEYVDQFSTRIRNANK*
Ga0137410_1148753013300012944Vadose Zone SoilVSLLHGGGLGGGAPAAHAESVLRGVQEYVDQFATRVRDANK*
Ga0126375_1113556123300012948Tropical Forest SoilSYQESPVLVQVSLLHKGGIAGGAAASHGAAVLRGLQEYVEQFSTRIHDANK*
Ga0164301_1033249623300012960SoilVELLHKGGLGGGSPAQHADAVTKSVLEYVDQFATRVKNANQ*
Ga0134077_1034044223300012972Grasslands SoilLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK*
Ga0134087_1041723413300012977Grasslands SoilQVSLLHKGSVAGGPPANHATAVLRGLQDYVDQFCSRIQAANK*
Ga0157371_1057283423300013102Corn RhizosphereAAKLPHTSSPVLLQAELLHKGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK*
Ga0157378_1042762723300013297Miscanthus RhizosphereVELQVELLHKGGLAGGAPAQNGASVTKSVLEYVDQFTTRIKNANK*
Ga0120111_108762513300013764PermafrostLSYQETPVLVQVSLLHKGGIAGGAPAAHAEGVLRGVQEYVDQFSTRIRDANK*
Ga0157380_1315958213300014326Switchgrass RhizosphereESPVLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK*
Ga0157377_1016928313300014745Miscanthus RhizosphereHKGGLTGGGPGVHADGVLKSVLEYVDQFSTRVRDANK*
Ga0157376_1105844413300014969Miscanthus RhizosphereGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK*
Ga0173483_1004733533300015077SoilAQLTHTAATVLVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK*
Ga0132256_10243062223300015372Arabidopsis RhizosphereARLTHTASPVLLQVELLHKGGLAGGGPAVHPDSMLKSVLEYVDQFSTRIRNANK*
Ga0132256_10371886113300015372Arabidopsis RhizosphereLPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK*
Ga0132257_10083792723300015373Arabidopsis RhizosphereLQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK*
Ga0132255_10525425213300015374Arabidopsis RhizosphereSAAKLPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK*
Ga0187788_1046195513300018032Tropical PeatlandVLVQVSLLHRGGLAGGSGAAHAESVLRGLQEYVDLFTTQIRTANSQK
Ga0184620_1009663113300018051Groundwater SedimentLLHKGGIAGGAPAAHADGVLRGVQEYVDQFATQIRNANK
Ga0184611_101245033300018067Groundwater SedimentLVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK
Ga0190271_1194556413300018481SoilLLQVELLHKGGLAGGGPAAHADGVLKNVLEYVDQFTTRIRSANN
Ga0210384_1122534633300021432SoilLHRGGIAGGASAAHAEGVLRGVQEYVDQFSTRIREANK
Ga0207697_1015566313300025315Corn, Switchgrass And Miscanthus RhizosphereHKGGLTGGGPGVHADGVLKSVLEYVDQFSTRVRDANK
Ga0207662_1019882923300025918Switchgrass RhizospherePLAHTAAPVELQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK
Ga0207690_1123801923300025932Corn RhizosphereLSYQDKPVLVQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK
Ga0207704_1083246113300025938Miscanthus RhizosphereLLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSLRIRNAGK
Ga0207711_1033188313300025941Switchgrass RhizosphereLLVQVSLLHKGGIAGGAPASHAEGVLRGVKQYVDQFATRIRDANK
Ga0207711_1136721523300025941Switchgrass RhizosphereVELQVELIHKGGLAGGSPAVHADAVTKNVLELVDQFATRVRDANK
Ga0207703_1117840613300026035Switchgrass RhizosphereLLHKGGIAGGAPTPHAEGVLRGVQESVDQFSTRIRDANR
Ga0207639_1052277013300026041Corn RhizosphereAKLPHTSSPVLLQAELLHKGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK
Ga0207678_1057831423300026067Corn RhizosphereLVEVSLLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ
Ga0207641_1058833423300026088Switchgrass RhizosphereVLLQVELLHKGGIAGGAPGAHADGVTKSLLEYVDQFSNRIRNAGK
Ga0207675_10174953223300026118Switchgrass RhizosphereLLHKGGLAGGASATHADAVLRGVQEYVDQFATRIHDANK
Ga0209468_109737823300026306SoilSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK
Ga0209058_131530213300026536SoilTPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK
Ga0209998_1003865813300027717Arabidopsis Thaliana RhizosphereSAAKLPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK
Ga0209701_1071404813300027862Vadose Zone SoilLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIHDANK
Ga0307285_1007462713300028712SoilVQLLRKGGLTGGAPAVHGAGVVKGVEDYLDQFITRIAAANK
Ga0307309_1014650023300028714SoilTTAKLSYQETPVLVQVSLLHKGGIGGGTPAAHAAEVLRNVQEYVDQFATRIRDANK
Ga0307282_1058991813300028784SoilQVSLLHKGGIAGGAAAAHAEGVLRGVQEYVDQFTGRIRDANKP
Ga0307312_1064969413300028828SoilYQKTPVLVQVSLLHKGGIAGGAAAAHAEAVLRGVQEYVDQFSTRIREANK
Ga0307499_1021550023300031184SoilLLQVELLHKGGLAGGGPAAHADGVLKSVLEYVDQFSTRIRDANK
Ga0310888_1036418423300031538SoilQLTHTAATVLVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK
Ga0310915_1055341623300031573SoilQDTPVLVQVSLLHRGGLAGGSPAPHADGVIRGLQEYVDQFSARIRAANN
Ga0310813_1013566113300031716SoilLLQAELLHKGGLAGAGPAAHADGVLKNVLEYVDQFSTRIRDANK
Ga0310813_1059947613300031716SoilVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIRNAGK
Ga0307473_1078739823300031820Hardwood Forest SoilHKGGIAGGTSASHAEAVLRGVQEYVDQFSTRIRNANK
Ga0310904_1043415623300031854SoilHTTAPVLLQVELLHKGGLAGGGPGVHADGVLKSVLEYVDQLSTRVRDANK
Ga0310904_1112334113300031854SoilTVLLQVELLHKGGLTGGGPGVHADGVMKSVLEYLDQFSTRVRDANK
Ga0310893_1055508113300031892SoilELLHKGGLAGGGPAVHADGVLKSVLEYVDQFATRIRDANK
Ga0310900_1011141013300031908SoilLHKGGLAGGGAAVHADGLLKNVLEYVDQFSTRIRNANN
Ga0310900_1027831013300031908SoilAAPLAHTSAPVLLQVELLHKGGLAGGSPAQHADAVTQSVLEYVDQFATRVKNANQ
Ga0306921_1034056313300031912SoilAKLSYQDTPVLVQVSLLHRGGLAGGSPAPHADGVIRGLQEYVDQFSARIRAANN
Ga0306921_1075386033300031912SoilVSLLHKGGIAGGPSTQHGDAVLRGVQEYIDQFLTRIRDANK
Ga0306926_1131781833300031954SoilKLSYQTTPALVQVSLLHKGGIAGGPSTQHGDAVLRGVQEYIDQFLTRIRDANK
Ga0310897_1026668523300032003SoilHTTAPVLLQVELLHKGGLAGGGPGVHADGVLKSVLEYVDQFSTRVRDANK
Ga0310906_1125143713300032013SoilHTESPVLLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIRNAGK
Ga0316624_1165161623300033486SoilDTPVLVQVSLMHKGGLAGGAPAAHAEGVLRGVKQYVDQVAARIRDANK
Ga0316630_1137981623300033487SoilAAAKLTHTASPVLVQVELLHKGGLAGAGPAVHGDGVLKSVLEYVDQFATRVSAANR
Ga0364927_0028349_1216_13743300034148SedimentLTHTASTVLLQVELLHKGGLAGGGPAVHADGVLKNVLEYVDQFSTRIRDANR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.