NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095536

Metagenome / Metatranscriptome Family F095536

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095536
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 167 residues
Representative Sequence MKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKTTNTTSDMILSPVATS
Number of Associated Samples 93
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.69 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 96.19 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.048 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(31.429 % of family members)
Environment Ontology (ENVO) Unclassified
(38.095 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.571 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 5.67%    β-sheet: 31.44%    Coil/Unstructured: 62.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF16967TcfC 1.90
PF13505OMP_b-brl 1.90
PF00571CBS 0.95



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.05 %
UnclassifiedrootN/A0.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002128|JGI24036J26619_10112768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300004156|Ga0062589_102409331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album543Open in IMG/M
3300004480|Ga0062592_101730487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium609Open in IMG/M
3300004643|Ga0062591_100883243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium836Open in IMG/M
3300005330|Ga0070690_101552537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300005333|Ga0070677_10823354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album532Open in IMG/M
3300005335|Ga0070666_11219045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300005337|Ga0070682_100389423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1051Open in IMG/M
3300005340|Ga0070689_100965677All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium756Open in IMG/M
3300005353|Ga0070669_101585753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → Winogradskyella psychrotolerans570Open in IMG/M
3300005354|Ga0070675_101633624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album595Open in IMG/M
3300005354|Ga0070675_102236506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300005364|Ga0070673_101947564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300005459|Ga0068867_101617653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300005539|Ga0068853_101871305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300005543|Ga0070672_100661585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium913Open in IMG/M
3300005543|Ga0070672_102087716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300005564|Ga0070664_101847378All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium573Open in IMG/M
3300006046|Ga0066652_102083387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300006358|Ga0068871_102159112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300006358|Ga0068871_102413201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300006881|Ga0068865_101852294All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300009094|Ga0111539_12488583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300009101|Ga0105247_11054332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium638Open in IMG/M
3300009156|Ga0111538_11151584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium980Open in IMG/M
3300009156|Ga0111538_12362311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300009176|Ga0105242_10045838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3544Open in IMG/M
3300009177|Ga0105248_12932476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300009527|Ga0114942_1161960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium787Open in IMG/M
3300009678|Ga0105252_10366986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium655Open in IMG/M
3300010154|Ga0127503_10919555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300010375|Ga0105239_12995891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300010397|Ga0134124_11489682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium704Open in IMG/M
3300011332|Ga0126317_10828797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300012212|Ga0150985_111034217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium569Open in IMG/M
3300012469|Ga0150984_102693260All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium854Open in IMG/M
3300012882|Ga0157304_1035236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300012884|Ga0157300_1071129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300012891|Ga0157305_10096517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium722Open in IMG/M
3300012892|Ga0157294_10178413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300012893|Ga0157284_10067775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium859Open in IMG/M
3300012898|Ga0157293_10055379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium897Open in IMG/M
3300012899|Ga0157299_10045814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium960Open in IMG/M
3300012901|Ga0157288_10150397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300012902|Ga0157291_10035826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1098Open in IMG/M
3300012903|Ga0157289_10437856All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300012904|Ga0157282_10169672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium681Open in IMG/M
3300012906|Ga0157295_10085905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium833Open in IMG/M
3300012907|Ga0157283_10052197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium942Open in IMG/M
3300012908|Ga0157286_10339250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300012909|Ga0157290_10186645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300012910|Ga0157308_10136943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium766Open in IMG/M
3300012914|Ga0157297_10196868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300012957|Ga0164303_11334604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300012987|Ga0164307_10211050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1329Open in IMG/M
3300013096|Ga0157307_1079953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300013297|Ga0157378_11701950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300013306|Ga0163162_10022661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6192Open in IMG/M
3300013307|Ga0157372_12662108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium574Open in IMG/M
3300013308|Ga0157375_11047116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium954Open in IMG/M
3300014326|Ga0157380_11005830All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300014326|Ga0157380_12993874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300014745|Ga0157377_10908355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300014868|Ga0180088_1107819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
3300015201|Ga0173478_10860300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300015257|Ga0180067_1092313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium679Open in IMG/M
3300015372|Ga0132256_102223185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium653Open in IMG/M
3300015373|Ga0132257_104237170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300017792|Ga0163161_11755186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300017965|Ga0190266_11167762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300018051|Ga0184620_10288925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300018067|Ga0184611_1177687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium757Open in IMG/M
3300018067|Ga0184611_1264497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium605Open in IMG/M
3300018077|Ga0184633_10484752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300018082|Ga0184639_10375533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium738Open in IMG/M
3300018083|Ga0184628_10379256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium740Open in IMG/M
3300018476|Ga0190274_11068950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium885Open in IMG/M
3300018476|Ga0190274_11357419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium799Open in IMG/M
3300018476|Ga0190274_12568036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300018481|Ga0190271_10355481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1547Open in IMG/M
3300018481|Ga0190271_11920268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300019362|Ga0173479_10170542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium890Open in IMG/M
3300019362|Ga0173479_10697662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300019362|Ga0173479_10744333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300020000|Ga0193692_1013494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1987Open in IMG/M
3300020020|Ga0193738_1001676All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8828Open in IMG/M
3300022756|Ga0222622_10789460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium693Open in IMG/M
3300022894|Ga0247778_1059785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium972Open in IMG/M
3300022898|Ga0247745_1064604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300023078|Ga0247756_1017611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1054Open in IMG/M
3300023102|Ga0247754_1182778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300023266|Ga0247789_1042908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium818Open in IMG/M
3300025930|Ga0207701_11337361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300025940|Ga0207691_10374998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1215Open in IMG/M
3300025940|Ga0207691_10612864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium921Open in IMG/M
3300025945|Ga0207679_11407636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300025960|Ga0207651_10367240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1216Open in IMG/M
3300026023|Ga0207677_12199894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium513Open in IMG/M
3300026095|Ga0207676_12416890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300031226|Ga0307497_10264334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium774Open in IMG/M
3300031562|Ga0310886_10193339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1105Open in IMG/M
3300032012|Ga0310902_10522989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300032013|Ga0310906_11111452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300032122|Ga0310895_10604201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil31.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere6.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.86%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.90%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.90%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24036J26619_1011276813300002128Corn, Switchgrass And Miscanthus RhizosphereMKKLLHLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISDIFLPSVTISKGRELYL
Ga0062589_10240933113300004156SoilLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKTTNTTSDMILSPVATSRGREYIFKRNDNGTGKII
Ga0062592_10173048713300004480SoilMKKILLLFAFFPLLIQAQNDIKAKLGPNGKFLIVNSGTPPNEFIKLLIRETGEVNWYLDGQDLFIRDGFFQAFPDSPLHKYDFMHIDGLNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGSVNASYTIQQDDHIMIIDKTTNT
Ga0062591_10088324313300004643SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISEIFLPS
Ga0070690_10155253713300005330Switchgrass RhizosphereCQRNLFVKNDYHNTNSSDIQDTKSSDTIIKSINIYFKLYTMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKIRLLDGSSNYV
Ga0070677_1082335413300005333Miscanthus RhizosphereVKRLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGS
Ga0070666_1121904513300005335Switchgrass RhizosphereLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKATGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHVDGVNGRIGFNILGGYSDGSPGGETNLPLTSSVTLMGSIATKVRFLDGSNNYAIQEDDHIMIIDKTTNTNSEMILSPVGTSLGREYIFKRNDHGTGKINVKPAPGEKLNGIVDG
Ga0070682_10038942313300005337Corn RhizosphereMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNDSTPGNELVKLQIRETGEVNWYLDGKDLFIRDGFFKAFGPDSPQYKYDFMHVDGLNGRIGFNVLNGYSDGSPGGKNSLPLTSSVSLFGSIAYRVRTVNFSTASPTYNIKQDDHVLMLNKAD
Ga0070689_10096567723300005340Switchgrass RhizosphereMKKLLLLIAFFPLLIQAQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGSPGGEDNLPLTSSVTLMGSIATKIRLL
Ga0070669_10158575313300005353Switchgrass RhizosphereMKKLLLLLAFFPLLIQAQSVKAKLGTGGSFFILNHGTPGVDELVKFQIRETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHIMI
Ga0070675_10163362413300005354Miscanthus RhizosphereVKRLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGLNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYALQQDDHILIIDKL
Ga0070675_10223650613300005354Miscanthus RhizosphereFFPLLIQAQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGSPGGEDNLPLTSSVTLMGSIATKIRLLSGISNYVIQQDDHIMIIDKTDNTNSDMVLTPVATSRGREYIFKRND
Ga0070673_10194756413300005364Switchgrass RhizosphereLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHVDGANGRIGFNILNGFSDGTPGGENNLPLTSSVTLMGSIATKIRLLDGSSNYVIQQDDHIMIIDKNTNTNSDMILSPVATSQGREYIFKRNESSVGKIIVKPAAGE
Ga0068867_10161765313300005459Miscanthus RhizosphereVCQRNLFVKNNYQNTNSSDTQDTKSSDTIIKSGKIYFKLYTMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGLFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSSNYIIQQDDHIMIIDKTVNTTSNMVLS
Ga0068853_10187130513300005539Corn RhizosphereTNFINHKNLTIKNLTMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNDSTPGNELVKLLIKETGEVNWYLDGKDLFIRDGFFDAFGDGKLYKYDFMHIDGTTGRIGFNILGGYSDGSPGGENNLPLTSSVTMMGSIATKLRLLDGSTNYGVKQDDHILIINKTDNTTSDITLSPVATSLGREYIFKRNDNGT
Ga0070672_10066158513300005543Miscanthus RhizosphereMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNDSTPGNELVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYVIQQDDHIMIIDQTTNTETDMILSPVATSR
Ga0070672_10208771613300005543Miscanthus RhizosphereQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGTPGGENNLPLTSSVTLMGSIATKIRLLTGISNYVIQQDDHIMIIDKTDNTNSDMILSPVATSQGREYIFKRNESSVGKIIVKP
Ga0070664_10184737813300005564Corn RhizosphereMKKLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGDGILHKYDFLHIDGANGRIGFNILGGKSDGTPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIID
Ga0066652_10208338713300006046SoilMKKLLLPLAFFPLIMQAQSVKAKLGTGGSFIILNHGTPGFDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGILHKYDFMHIDGVNGRIGFNILGGYSDGSPGGENNLPLTSSVTLQGSIATKVRLLDGSTNYAIQQDDHILIIDKTTNTE
Ga0068871_10215911213300006358Miscanthus RhizosphereGSFFILNHGTPGVDELVKFQIRETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDASTNYVIQQDDHILIIDKSTNTNSDMILSPVANSLGREYIFKRNGNGDGSIILKPAPGEKLNGIVDNTLVL
Ga0068871_10241320113300006358Miscanthus RhizosphereVKAKLGTGGSFFILNHGTPGVDELVKFQIRETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHVDGANGRIGFNILNGFSDGTPGGENNLPLTSSVTLQGSIATKVRLLNGITSYTIQQDDHIMIIDKADNTNSDMVFSPVATSRGREYIFKRNDNGTGKIIV
Ga0068865_10185229413300006881Miscanthus RhizosphereGTGGSFIILNSGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDASTNYVIQQDDHILIIDKSTNTNSDMILSPVANSLGREYIFKRNGNGDGSIILKPAPGEKLNGIVDNTLVLG
Ga0111539_1248858313300009094Populus RhizosphereVKKLLLLLAFFPLLIQAQSVKAKLGTGGSFLILNSGTPPNEFVKFQVRETGEVNWYLDGQDLFIRDGFLKALGPDSPQFKYDFMHIDGINGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGTTNYQIQQDDHILIVDKITNTESFMTLSPVGTSRG
Ga0105247_1105433223300009101Switchgrass RhizosphereMKKLLHLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILI
Ga0111538_1115158413300009156Populus RhizosphereMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGQDLFVRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSRGREYIFKRNDNGTGKI
Ga0111538_1236231113300009156Populus RhizosphereMKTLLLLLAFIPLLIQAQNVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGIKYKYDFMHIDGVNGRIGFNILNGYSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHV
Ga0105242_1004583833300009176Miscanthus RhizosphereMKKFLLLLSFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISDIFLPSVTISKGRELYLKRNGSGVGEISVLPQPGEQLNGVVNSNVSLNK
Ga0105248_1293247613300009177Switchgrass RhizosphereGNTVKAKLGVGGKFLVVNGGKPGVDEFVKLLIRETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKIRLLDGSSNYVIQQDDHIMIIDKNTNTNSDMILSPVATSLGREYIFKRNDNGTGKIIVKPAVGEKLNGI
Ga0114942_116196013300009527GroundwaterMKKFLLLLAFFPLLIQAQSVKAKLGAGGSFLVLDKGTPGVDEKVKLQFLETGEVRWYLDGQNLFIRDGFFDAFGTGTKYKYDFVHIDGQRGRIGFNILGGYSDGSPGGENDLPLTSSVTLQGSIATKVRLLNGITSYTIQQDDHIMIIDKADNTNSDMVLSPVATSRGREYIFKRNDNGTGKIIVKP
Ga0105252_1036698613300009678SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNGGTPGVDEFVKLLVKETGEVNWYLDGQDLFIRDGFFDAFGTGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRVLDGASNYVIKQDDHIMIIDKTDQLASDMILSPVATSL
Ga0127503_1091955513300010154SoilMKKFLLLLAFFPLLIQAQNIKTKLGKGGSFLILNDSTPGNELVKLQVRETGEVNWYLDGKDLFIRDGSFAAFPDSPLYKYDFMHIDGVTGRVGFNVLNGHSDGTPGGITSLPLTSSVSLFGSIAYRVRTVNFSTGSPNYNVKQDDNILMLNKADNSKNYIYMSLVANSKGRMYTLKR
Ga0105239_1299589113300010375Corn RhizosphereFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISDIFLPSVTISKGRELYLKRNGSGVGEISVLPQPGEQ
Ga0134124_1148968213300010397Terrestrial SoilMKKLLLLLAFFPLIIEAQNVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGTPGGENNLPLTSSVTLMGSIATKIRLLDGSSNYVIQQDDHIMI
Ga0126317_1082879713300011332SoilVKKLLLLLAFFPILIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLVKETGEVNWYLDGQDLFIRDGFFDAFGTGELFKYDFMHVDGVRGRIGFNILGGHSDGSPGGENNLPLTSSVTLLGSIATKVRLLDAATNYLIQQDDHILII
Ga0150985_11103421713300012212Avena Fatua RhizosphereMKKFLLLLAFFPLFIQAQSVKAKLGTGGSFIILNSGTSGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGDGTLYKYDFMHIDGANGHIGFNILNGFSDGSPGGETNLPLTSSITLMGSIATKVRFLDGSNNYAIQQDD
Ga0150984_10269326013300012469Avena Fatua RhizosphereMKKLLLLLAFFPLLIQAQNVKAKLGAGGSFLILDKGAPGTDELVKLQIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHVDGANGRIGFNILNGFSDGSPGGENNLPLTSSVTLNGSIATKVRLLDGSTNYAIQQDDHILIVDKTTNTTSDMILSPVATSRGREYIFKRNDNKTGKINVRP
Ga0157304_103523613300012882SoilMKKLLLLLAFFPLLAQAQNVKAKLGTGGSFIILNSGTPPNEFVKFLVKETGEVNWYLDGQDLFIRDGFFDAFGNGIFHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRL
Ga0157300_107112913300012884SoilLIQAQNVKAKLGTGGSFLILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFQAFPDSPLHKYDFMHIDGLNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYALQQDDHILIIDKLTNTESEIALSSVATSRGREYIFKRNDNGTGKITVKPALGEKLNGLVNGSVSLNSENST
Ga0157305_1009651713300012891SoilMKKLLLLLAFFPLLIQAQNVKAKLGKGGNFLILNDSTPGDELIKLQIRETGEVNWYLDGQHFFLRDGFFDAFGTGTNYKYDFINIDGANGRIGFNVLGGFSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGATNYVIQQDDHILIIDQAINSEVDMVLSPV
Ga0157294_1017841313300012892SoilFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFKALGPDSPQFKYDFMHIDGINGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGTTNYQIQQDDHILIVDKITNTESFMTLSPVVTSRGREYIFKRNASGTGKITVRPEPGEKLNGVVDATVSLNSENSTL
Ga0157284_1006777513300012893SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGIFHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSLGASYTIQQDDHIMI
Ga0157293_1005537913300012898SoilVKRLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGADEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGLNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGGTTYAIQQDDHIMIIDKTTNTTSDMILSPVATSKGREYIFKRNDNGTGKITVKPALGEKLNGIVNG
Ga0157299_1004581413300012899SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSVGASYTIQQDDHIMIIDKTTNTNTDMVLSPVANSKGREYIFRRNGTSTGKIIVKPA
Ga0157288_1015039713300012901SoilMKKILLLLAFFPFLIQAQNVKAKLGTGGSFIILNAGAPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHADGSPGGENNLPLTSSVTLMGSIATKVRLLDASTNYAIQQDDHILIIDKNTNTNSDMILSPVANSLGREYIFK
Ga0157291_1003582613300012902SoilMKKLLLLLAFFPLLAQAQNVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFQAFPDSPLHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHIMIIDKITNTNTDMVLSPVATSLGREYIFKRRETGAGKIIVKPA
Ga0157289_1043785613300012903SoilHHNTNSSDTQDTKSSDTIIKSGNIYFKLYTMKRILLLLAFFPLLIQAQNVKAKLGKGGNFLILNDSTPGDELIKLQIRETGEVNWYLDGQHFFLRDGFFDAFGTGTNYKYDFINIDGANGRIGFNVLGGFSDGTPGGETNLPLTSSVTLMGSIATKVRLLDGSTNYA
Ga0157282_1016967213300012904SoilMKKILLLFAFFPLLIQAQNDIKAKLGPNGKFLIVNSGTPPNEFIKLLIRETGEVNWYLDGQDLFIRDGFFLAFADSPLHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIDTKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSRGR
Ga0157295_1008590513300012906SoilVKKLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFVNIDGAAGRIGFNILSGHSDGSPGGENNLPLTSSVTLMGSIATKVR
Ga0157283_1005219713300012907SoilMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFKAFGPDSPQFKYDFMHIDGINGRIGFNILGGKSDGTPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSPVATSRGREYIFKRNDNGTGKIIVKP
Ga0157286_1033925013300012908SoilMKTLLLLLAFFPLLIQAQNVKAKLGTGGSFIILNSGTPGQDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGILHKYDFMHIDGLNGRIGFNILGGKSDGTPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSRGREYIFK
Ga0157290_1018664513300012909SoilMKTLLLLLAFFPLLIQAQSIKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDALGTGTLYKYDFMHIDGINGRIGFNILNGFSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHIMIIDKTTNTTSDMVLSPVATSRGREYIFKRNDN
Ga0157308_1013694313300012910SoilMKKILLLLAFFPFLIQAQNVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTFYKYDFMHIDGLNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGS
Ga0157297_1019686813300012914SoilMKKFLLLLAFFPLLIQAQNVKAKLGTGGNFIILNAGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFQAFPDSPLHKYDFMHIDGLNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKV
Ga0164303_1133460413300012957SoilQGNVNIQAQSIKTKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHVDGANGRIGFNILNGFSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSSNYVIQQDDHILIIDKNINTESDMVLSPVATSRGREYIFKRNNNGTGKINLK
Ga0164307_1021105013300012987SoilMKTLLLLLAFFPLLIQAQNVKAKLGTGGSFIILNHGTPGVDEFVKLLVKETGEVNWYLDGQDLFIRDGFFNAFGDGIKYKYDFMHIDGVNGRIGFNILNGFSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGSSNYVIQQDDHVMIIDKTDNTNSDMILSPVATSLGREYIFKRNESSTGKIIVKTAPGEKLN
Ga0157307_107995323300013096SoilMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIVLNSGTPPNEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGDGTLYKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKIRLLDGSTNYVIQQDDHIMIIDKTTNTT
Ga0157378_1170195013300013297Miscanthus RhizosphereMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGTPGGENNLPLTSSITLMGSIATKVRLLDGSSNYVIQQDDHIMIIDKTDN
Ga0163162_1002266153300013306Switchgrass RhizosphereMKKFLLLLSFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILNGFSDGTPGGENNLPLTSSITLMGSIAT
Ga0157372_1266210813300013307Corn RhizosphereGGSLNLFAGTTAAGLLGDVNIQGKNVKAKLGKGGKFLIVNDSTPGNELIKLLIRETGEVNWYLDGQDLFMRDGFFDAFGTGTLYKYDFMHVDGVNGRIGFNILGGYSDGSPGGENNLPLTSSVTLMGSIATKLRLLDGSTNYGVKQDDHILIINKTDNTTSDITLSPVATSLGREYIFKRNDNGTGKIIVK
Ga0157375_1104711613300013308Miscanthus RhizosphereMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKIRLLDGSSNYVIQQDDHIMIIDKNTNTNSDMILSPVATSLGREYIFKRNENST
Ga0157380_1100583013300014326Switchgrass RhizosphereMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGKDLFIRDGFFDAFGDGIHYKYDFMHIDGVTGRIGFNILGGKSDGSGGENNLPLTSSVTLMGSIATKVRLLDGSSNYVIQQDDHILIIDQAINSEVDMVLSPV
Ga0157380_1299387413300014326Switchgrass RhizosphereLLLLAFFPLLIQAQSVKAKLGTGGSFFILNHGTPGVDELVKFQIRETGEVNWYLDGQDLFIRDGFFDAFGTGTFYKYDFMHIDGINGRIGFNILNGFSDGSPGGENNLPLTSSVTLMGSIATKVRILDAANNYVIQQDDHILIVDKITNTESFMTLSPVGTSRGREYIFKRNASGTGK
Ga0157377_1090835513300014745Miscanthus RhizosphereMKTLLLLVAFSPLLIQAQSVKAKLGTGGSFIILNSGTPPNEFVKFLVKETGEVNWYLDGQDLFIRDGFFDAFGDGTTYKYDFMHIDGINGRIGFNILGGYSDGSPGGENNLPLTSSVTMMGSIATKLRLLDGSTNYAVKQDDHILIIN
Ga0180088_110781913300014868SoilKLYTMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIILNGGTPGVDEFVKLLVKETGEVNWYLDGQDLFFRDGFFDAFGTGTLYKYDFMHVDGVNGRIGFNILGGFSDGTPGGENNLPLTSSVTLQGSIATKVRLLNGITSYTIQQDDHIMIIDKADNTNSDMVLSPVA
Ga0157376_1313372813300014969Miscanthus RhizosphereTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGNFNAFPDSPLYKYDFMHIDGLNGRIGFNVLNGHSDGTPGGITSLPLTSSVSLFGSIAYRVRTINFSSASPTYSIKQDDHILMINKADNAPGNIFLTPVANSKGRVYTLKRDQTKDGDIFVRPQGGEKLNGVVDKD
Ga0173478_1086030013300015201SoilGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGTEGGITSLPLTSSISLFGSLAYRVRTVIFSSGSPTYNAKQDDNILMLTKADNARADLIMSPVAVSKGRMYTLKRDQTKDGDIFV*
Ga0180067_109231323300015257SoilMKKFLLLIAFFPLLIQAQNDIKAKLGAGGKFIIVNSGTPPNEFIKLLIRETGEVNWYLDGQDLFIRDGFFDAFGTGALYKYDFMHIDGLNGRIGFNILGGKSDGSAGGENNLPLTSSVTLMGSIATKVRVLDGSTNYVIQQDDHVMIIDKTINTTSDMVLSPVATSRGREYIFKRNESSV
Ga0132256_10222318513300015372Arabidopsis RhizosphereDTKSSDTIIKSGKIYFKLYTMKKILLLLAFFPLLIQAQSVKAKLGTGGSFLILNNGTPGIDEFVKLQIRENGEVNWYLDGKDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILDGHSDGSPGGETNLPLTSSVTLMGSIATKVRLLDGSSNYVIQQDDHIMIIDKNTNTNSDMILSPVATSLGREYIFKRNENSTGKIIVKPALGEKLNGIV
Ga0132257_10423717013300015373Arabidopsis RhizosphereTTAAGLQGNVNIQAQSIKTKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVNWYLDGQDLFMRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILGGKSDGTPGGENNLPLTSSVTLQGSIATKVRLLDGSTSYNIQQDDHIMIIDKNVNTNSIMTLSPVATSRGREYIFKRN
Ga0163161_1175518613300017792Switchgrass RhizosphereMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNDSTPGNELVKFQVRETGEVNWYLDGQDLFIRDGFFDAFGDGIKYKYDFMHIDGLNGRIGFNILNGYSDGSPGGENNLPLTSSVTLMGSIATKVRLLNGLTTYAIQQDDHIMI
Ga0190266_1116776213300017965SoilMKKFLLLLAFFPLLIQAQNVKAKLGTGGSFIILNSGTPPNEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILI
Ga0184620_1028892513300018051Groundwater SedimentFKSGTFILKIYTMKKPLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGQDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILNGFSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYAIQQDDHIMIINKTDNVNTDMILSPVATSLGREY
Ga0184611_117768713300018067Groundwater SedimentMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGVSDIFLPSVTISKGRELYLKRNG
Ga0184611_126449713300018067Groundwater SedimentLTMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPPNEFVKLLIKETGEVNWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNILGGFSNGNPGGENNLPLTSSVTLMGSIATKVRVLDGGTNYVIKQDDHIMIIDKITNTNTDMVLSPVATSLGREYIFKRRETGAGKIIVKPAPGEKLNGLVDG
Ga0184633_1048475223300018077Groundwater SedimentMKKPLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFVRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRVLDGGTNYVIKQDDHIM
Ga0184639_1037553323300018082Groundwater SedimentMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFFILNGGTPPNELVKLQIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSGAGSIYLKETIMVQVKLL
Ga0184628_1037925623300018083Groundwater SedimentMKKILLLFAFFPLLIQAQSVKAKLGTGGSFIILNGGTPGQDEFVKLLIKETGEVNWYLDGQELFIRDGFFDAFGTGIKYKYDFMHIDGVNGRIGFNILGGFSDGSPGGENNLPLTSSVTLNGSIATKVRLLNGLTSYTIQQDDHIMIIDKTDNTNSDMVLTPVATSRGREYIFKRN
Ga0190274_1106895013300018476SoilMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNAGTPGVDEFVKLLIKETGEVNWYLDGQDLFVRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVR
Ga0190274_1135741923300018476SoilMKKILLLFAFFPLLIQAQNVKAKLGKGGNFLILNDSTPGNELIKLQIRETGEVNWYLDGQHFFLRDGFFDAFGTGTNYKYDFINIDGQNGRIGFNILGGFSDGSPGGEDNLPLTSSVTLMGSIATKVRLLNGLTTYQIQQDDHIMIIDKTTNTNTDMTLSPVANSKGRGYIFRRNGTSTGKIIVKPALGEKLNGILNGSATL
Ga0190274_1256803613300018476SoilMKTLLLLLAFFPLFIQAQSVKAKLGTGGSFIILNAGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFLHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYVIQQDDHILIIDKTTNTTS
Ga0190271_1035548113300018481SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNAGTPGLDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGDGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQ
Ga0190271_1192026813300018481SoilMKTLLLLLAFFPLFIQAQSVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGKDLFIRDGFFDAFGDGTTYKYDFMHIDGVNGRIGFNILGGKSDGSGGENNLPLTSSVTLMGSIATKVRLLDG
Ga0173479_1017054223300019362SoilVKKLLLLLVFFPFLIQAQNVKAKLGTGGSFIILNSGTPGADEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSPVATSRGREYIFKRNDNGTGKIIVKPAPGEKLNGLVDGSITLGAENSTLE
Ga0173479_1069766213300019362SoilLLLLAFFPLLIQAQNVKAKLGTGGSFLILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFQAFPDSPLHKYDFMHIDGLNGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGSVGASYTIQQDDHIMIIDKTTNTNTDMVLSPIATSKGREYIFRRNGTSTGKII
Ga0173479_1074433313300019362SoilIRSGKIYFKLYTMKKNLLLFAFFPLLIQAQNVKAKLGTGGSFIILNSGTPGADEFVKLLIKETGEVNWYLDGQHLFIRDGFFDAFGNGILHKYDFVNIDGATGRIGFNILSGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYEIQQDDHILIIDKTTNTTSDMILSHVATS
Ga0193692_101349413300020000SoilMKKLLLLLAFFPLLIQAQSVKAKLGTGGSFFILNHGTPGVDELVKFQIRETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGLNGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSPVATSRGREYIFKRNDNGTGKIIVKPALGEK
Ga0193738_100167613300020020SoilMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGILHKYDFMHIDGVNGRIGFNILGGKSDGSLGGENNLPLTSSVTLMGSIATKVRL
Ga0222622_1078946013300022756Groundwater SedimentMKKLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILI
Ga0247778_105978513300022894Plant LitterMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFLILNSGTPPNEFVKFQVRETGEVNWYLDGQDLFIRDGFFKAFGPDSPQFKYDFMHIDGINGRIGFNILNGFSDGSPGGENNLPLTSSITLMGSIATKVRLLDGSTNYALQQD
Ga0247745_106460413300022898SoilMKTLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKTTNTTSDMILSPVATS
Ga0247756_101761123300023078Plant LitterMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNDSTPGNELVKFQVRETGEVNWYLDGQDLFIRDGFFDAFGTGILHKYDFMHIDGLHGRIGFNILGGHSDGSPGGENNLPLTSSVTLMGSIATKVRLLDASTNYVIQQDDHILIIDKSTNTNSDMILSPVANSLGREYIF
Ga0247754_118277813300023102SoilIIKSGKIYFKLYTMKKILLLLPFFPLLIQAQSVKAKLGTGGSFLILNSGTPPNEFVKFQVRETGEVNWYLDGQDLFIRDGFFKAFGPDSPQFKYDFMHIDGINGRIGFNILGGHSDGTPGGENNLPLTSSVTLMGSIATKVRLLDGTTNYQIQQDDHILIVDKITNTESFMTLSP
Ga0247789_104290813300023266SoilMKKILLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGIFHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSRGR
Ga0207701_1133736113300025930Corn, Switchgrass And Miscanthus RhizosphereKSSDTIIKSINIYFKLYTMKKFLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRILDAATNYEIQQDDHILIIDKTTNTTSDMILSHVATSRGREYIFKRN
Ga0207691_1037499823300025940Miscanthus RhizosphereVKRLLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGSPGGEDNLPLTSSVTLMGSIATKIRLLTGISNYVIQQDDHIMIIDKTDNTNSDMILTPVAIS
Ga0207691_1061286423300025940Miscanthus RhizosphereMKTLLLLLAFFPLLIQAQNVKAKLGKTGSFLILNGGIPGTSEKVKLQIRETGQVSWYLDGQDLFMRDGFFDAFGDGKLYKYDFMHVDGATGRIGFNILGGYSDGSGGENNLPLTSSVTLMGSIATKVR
Ga0207679_1140763613300025945Corn RhizosphereNFGIPLIFINHDPKTLLTMKKLLLLLAFFPLLIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGDGILHKYDFLHIDGANGRIGFNILGGKSDGTPGGENNLPLTSSVTLMGSIATKVRLLDASTNYAIQQDDHIMIIDKSTNTNSNMILSPVATSRGREYIFKRNNNGTGKIIVKPATGEKLNG
Ga0207651_1036724013300025960Switchgrass RhizosphereMKTLLLLVAFSPLLIQAQSVKAKLGTGGSFIILNSGTPPNEFVKFLVKETGEVNWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISEIFLPSVTISKGR
Ga0207677_1219989413300026023Miscanthus RhizosphereMKKLLHLLAFFPLLIQVQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGTGTLYKYDFMHIDGVNGRIGFNILNGFSDGSPGGEDNLPLTSSVTLMGSIATKIRLLT
Ga0207676_1241689013300026095Switchgrass RhizosphereLLLLSFFPLLIQAQSVKAKLGTGGSFIILNHGTPGVDEFVKLLIKETGEVDWYLDGQDLFIRDGFFNAFGPDSPLYKYDFMHIDGVNGRIGFNVLNGHSDGSPGGKNSLPLTSSVNLFGSIATRVRVVDGTTNYAIQQDDHILIIDKQDNGISDIFLPSVTISKGRELYLKRN
Ga0307497_1026433413300031226SoilMKKILLLLAFFPLLVQAQNVKAKLGTGGSFFILDHGTPGTDELVKLQIRETGEVNWYLDKQNLFIRDGFFDAFGTGTLYKYDFMHIDGATGRIGFNILGGYSDGTPGGETNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKNINTESDMVLSPVATS
Ga0310886_1019333923300031562SoilMKKFLLLLAFFPLLIQAQSVKAKLGLGGSFIILNNGTPGVDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGKSDGSPGGENNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKTDNTTSDMILSPVATSL
Ga0310902_1052298913300032012SoilMKTLLLLLAFFPLLIQAQDIKAKLGTGGKFLILDGGTPGINEFVKLQIRENGEVNWYLDKQNLFIRDGNFEAFPGQPLYKYDFLHIDGATGRIGFNILEGYSDGSPGGETNLPLTSSVTLMGSIATKVRLLDGSSNYVIQQDDHVMIIDKTVNTISDMILSPVATSR
Ga0310906_1111145213300032013SoilINHFITMKTLLLLLAFSPLLIQAQDIKAKLGTGGKFLILDGGTPGINEFVKLQIRENGEVNWYLDKQNLFIRDGNFEAFPGQPLYKYDFLHIDGATGRIGFNILEGYSDGSPGGETNLPLTSSVTLMGSIATKVRLLDGSTNYVIQQDDHILIIDKTTNTTSDMILSPVATSRGREYIFKRNDNGTGKII
Ga0310895_1060420113300032122SoilMKKILLLLAFFPLLIQAQNVKAKLGTGGSFIILNHGTPGFDEFVKLLIKETGEVNWYLDGQDLFIRDGFFDAFGNGILHKYDFMHIDGVNGRIGFNILGGHSDGSPGGENNLPLTSSITLMGSIATKVRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.