NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095299

Metagenome Family F095299

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095299
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 47 residues
Representative Sequence MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP
Number of Associated Samples 88
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 40.95 %
% of genes near scaffold ends (potentially truncated) 40.95 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(7.619 % of family members)
Environment Ontology (ENVO) Unclassified
(48.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(72.381 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.59%    β-sheet: 0.00%    Coil/Unstructured: 55.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13520AA_permease_2 5.71
PF02311AraC_binding 3.81
PF00082Peptidase_S8 3.81
PF00756Esterase 2.86
PF07676PD40 2.86
PF07366SnoaL 2.86
PF03992ABM 1.90
PF04679DNA_ligase_A_C 1.90
PF01068DNA_ligase_A_M 1.90
PF00326Peptidase_S9 1.90
PF07732Cu-oxidase_3 1.90
PF13191AAA_16 0.95
PF04471Mrr_cat 0.95
PF01520Amidase_3 0.95
PF00400WD40 0.95
PF10647Gmad1 0.95
PF00266Aminotran_5 0.95
PF01566Nramp 0.95
PF01479S4 0.95
PF13738Pyr_redox_3 0.95
PF14534DUF4440 0.95
PF12544LAM_C 0.95
PF13683rve_3 0.95
PF00069Pkinase 0.95
PF02810SEC-C 0.95
PF01548DEDD_Tnp_IS110 0.95
PF12697Abhydrolase_6 0.95
PF13335Mg_chelatase_C 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.81
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 3.81
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 1.90
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 1.90
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.95
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.95
COG3547TransposaseMobilome: prophages, transposons [X] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.43 %
UnclassifiedrootN/A48.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_112262383Not Available1223Open in IMG/M
3300000956|JGI10216J12902_118616461Not Available630Open in IMG/M
3300004114|Ga0062593_100043911All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_32713Open in IMG/M
3300004114|Ga0062593_100088120Not Available2134Open in IMG/M
3300004156|Ga0062589_100999871All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300004480|Ga0062592_100006407Not Available4279Open in IMG/M
3300004480|Ga0062592_100874957Not Available806Open in IMG/M
3300005093|Ga0062594_102117239Not Available605Open in IMG/M
3300005093|Ga0062594_103047591Not Available523Open in IMG/M
3300005328|Ga0070676_10535697Not Available836Open in IMG/M
3300005329|Ga0070683_100073367All Organisms → cellular organisms → Bacteria3196Open in IMG/M
3300005329|Ga0070683_102210604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium528Open in IMG/M
3300005331|Ga0070670_100021603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5535Open in IMG/M
3300005338|Ga0068868_100843320Not Available830Open in IMG/M
3300005339|Ga0070660_101066984Not Available683Open in IMG/M
3300005341|Ga0070691_10454271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Emcibacterales → Emcibacteraceae → Paremcibacter → Paremcibacter congregatus732Open in IMG/M
3300005344|Ga0070661_100203195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1515Open in IMG/M
3300005353|Ga0070669_100166222Not Available1717Open in IMG/M
3300005354|Ga0070675_100711439All Organisms → cellular organisms → Bacteria → Terrabacteria group915Open in IMG/M
3300005355|Ga0070671_100110764All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300005365|Ga0070688_100231184Not Available1308Open in IMG/M
3300005366|Ga0070659_100170367Not Available1783Open in IMG/M
3300005367|Ga0070667_102140756Not Available527Open in IMG/M
3300005440|Ga0070705_101887588Not Available508Open in IMG/M
3300005444|Ga0070694_101488629Not Available573Open in IMG/M
3300005535|Ga0070684_100133322All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300005616|Ga0068852_101196052Not Available781Open in IMG/M
3300005618|Ga0068864_100094422All Organisms → cellular organisms → Bacteria2644Open in IMG/M
3300005718|Ga0068866_10312940All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes985Open in IMG/M
3300005764|Ga0066903_107313577Not Available571Open in IMG/M
3300005834|Ga0068851_10981060Not Available532Open in IMG/M
3300005841|Ga0068863_102096274Not Available575Open in IMG/M
3300005841|Ga0068863_102540747Not Available521Open in IMG/M
3300006755|Ga0079222_10511275Not Available884Open in IMG/M
3300006804|Ga0079221_10726592Not Available697Open in IMG/M
3300006845|Ga0075421_100600273All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300006847|Ga0075431_100061621All Organisms → cellular organisms → Bacteria3871Open in IMG/M
3300006871|Ga0075434_100666053All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1059Open in IMG/M
3300009098|Ga0105245_10860120Not Available947Open in IMG/M
3300009100|Ga0075418_10022931All Organisms → cellular organisms → Bacteria6853Open in IMG/M
3300009100|Ga0075418_10370560All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300009148|Ga0105243_11928314Not Available624Open in IMG/M
3300009156|Ga0111538_10132549All Organisms → cellular organisms → Bacteria3165Open in IMG/M
3300009174|Ga0105241_11880582All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300009176|Ga0105242_10159073All Organisms → cellular organisms → Bacteria1975Open in IMG/M
3300009177|Ga0105248_11599683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma endbachense738Open in IMG/M
3300009551|Ga0105238_10280306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium1648Open in IMG/M
3300009551|Ga0105238_11422617Not Available721Open in IMG/M
3300009553|Ga0105249_10301216All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300009553|Ga0105249_10671206All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300010397|Ga0134124_11509967Not Available700Open in IMG/M
3300011000|Ga0138513_100081005All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300011119|Ga0105246_12593050Not Available501Open in IMG/M
3300012212|Ga0150985_109526631Not Available2193Open in IMG/M
3300012955|Ga0164298_10601761Not Available755Open in IMG/M
3300012958|Ga0164299_10707555Not Available705Open in IMG/M
3300012960|Ga0164301_10793930Not Available723Open in IMG/M
3300012985|Ga0164308_11595593Not Available602Open in IMG/M
3300012986|Ga0164304_10235766Not Available1218Open in IMG/M
3300012988|Ga0164306_11297411Not Available615Open in IMG/M
3300012989|Ga0164305_10067478All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300013102|Ga0157371_10264350All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300013296|Ga0157374_10772607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales976Open in IMG/M
3300013297|Ga0157378_10240846Not Available1728Open in IMG/M
3300013306|Ga0163162_11546479All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales756Open in IMG/M
3300014325|Ga0163163_12703244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia553Open in IMG/M
3300014745|Ga0157377_10086383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1843Open in IMG/M
3300015265|Ga0182005_1133113Not Available714Open in IMG/M
3300015371|Ga0132258_10070085All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae8129Open in IMG/M
3300015371|Ga0132258_11527228All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300015371|Ga0132258_12647366Not Available1252Open in IMG/M
3300015372|Ga0132256_100025049All Organisms → cellular organisms → Bacteria5339Open in IMG/M
3300015372|Ga0132256_101009889Not Available947Open in IMG/M
3300015374|Ga0132255_102040873All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium873Open in IMG/M
3300015374|Ga0132255_105240518Not Available549Open in IMG/M
3300022899|Ga0247795_1075361Not Available585Open in IMG/M
3300025899|Ga0207642_10332509All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes891Open in IMG/M
3300025919|Ga0207657_10155780Not Available1858Open in IMG/M
3300025919|Ga0207657_10408561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1068Open in IMG/M
3300025920|Ga0207649_11049398Not Available642Open in IMG/M
3300025923|Ga0207681_10713264Not Available834Open in IMG/M
3300025925|Ga0207650_10044091All Organisms → cellular organisms → Bacteria3277Open in IMG/M
3300025930|Ga0207701_10000029All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis110107Open in IMG/M
3300025933|Ga0207706_10025320All Organisms → cellular organisms → Bacteria5317Open in IMG/M
3300025936|Ga0207670_11639237Not Available547Open in IMG/M
3300025940|Ga0207691_10029589All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium5123Open in IMG/M
3300025944|Ga0207661_10073381All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300025944|Ga0207661_10264330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1534Open in IMG/M
3300026075|Ga0207708_10402025All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300026078|Ga0207702_10315533All Organisms → cellular organisms → Bacteria1487Open in IMG/M
3300026078|Ga0207702_10900635Not Available876Open in IMG/M
3300026088|Ga0207641_10263233Not Available1616Open in IMG/M
3300026095|Ga0207676_10091899All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300026116|Ga0207674_10593363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1070Open in IMG/M
3300026142|Ga0207698_10876186Not Available904Open in IMG/M
3300027909|Ga0209382_10290643All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300028380|Ga0268265_11863383Not Available608Open in IMG/M
3300028381|Ga0268264_11466375Not Available693Open in IMG/M
3300031538|Ga0310888_10066086All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300031716|Ga0310813_10389782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1196Open in IMG/M
3300031892|Ga0310893_10126720All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300031908|Ga0310900_10087607All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1959Open in IMG/M
3300031908|Ga0310900_11499051All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium569Open in IMG/M
3300032013|Ga0310906_11008461All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium599Open in IMG/M
3300032075|Ga0310890_11792352Not Available510Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11226238313300000956SoilKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
JGI10216J12902_11861646113300000956SoilVGTMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP*
Ga0062593_10004391133300004114SoilMNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVLTCPERP*
Ga0062593_10008812023300004114SoilMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP*
Ga0062589_10099987123300004156SoilVVECWCLMVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP*
Ga0062592_10000640713300004480SoilMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLAC
Ga0062592_10087495713300004480SoilVVECWCLMVETMNRVRLDTCETCRKFEAKDLEPLKWAIIRRRRVLAIQLLP*
Ga0062594_10211723923300005093SoilLMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP*
Ga0062594_10304759113300005093SoilLMVETMNRVRLDRFTRETWRKFDAKDLEPFKWAILGRRRVLAMQLP*
Ga0070676_1053569723300005328Miscanthus RhizosphereERMNRLTLDRFTRDIWRTFDATDLEPLKWAILRRRRVLAMQLRP*
Ga0070683_10007336713300005329Corn RhizosphereDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0070683_10221060423300005329Corn RhizosphereMVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAV
Ga0070670_10002160333300005331Switchgrass RhizosphereVVVECWCLMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0068868_10084332013300005338Miscanthus RhizosphereFTRETWRKFDPADLEPLKAAILRRRRVLAAPVRMLPVATLR*
Ga0070660_10106698423300005339Corn RhizosphereKTMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP*
Ga0070691_1045427123300005341Corn, Switchgrass And Miscanthus RhizosphereMVETMNRVRLDRFTRETWKKFDAKDLEPLEWVIIRRRRVPAMQLRP*
Ga0070661_10020319523300005344Corn RhizosphereVVECWCLMVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAVGCPVRP*
Ga0070669_10016622213300005353Switchgrass RhizosphereMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP*
Ga0070675_10071143913300005354Miscanthus RhizosphereMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0070671_10011076433300005355Switchgrass RhizosphereMTTKSPAPPVVVECWCLMVATMNRVRLDKFTRETWKKFDAKDPEPLKWAILRRRRVLACPVRP*
Ga0070688_10023118413300005365Switchgrass RhizosphereCLMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP*
Ga0070659_10017036733300005366Corn RhizosphereMVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP*
Ga0070667_10214075613300005367Switchgrass RhizosphereVVVECWCLMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP*
Ga0070705_10188758813300005440Corn, Switchgrass And Miscanthus RhizosphereMVADMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALQAWP*
Ga0070694_10148862923300005444Corn, Switchgrass And Miscanthus RhizosphereMNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVPTCPERP*
Ga0070684_10013332213300005535Corn RhizosphereVVECWCLMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0068852_10119605223300005616Corn RhizosphereRVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP*
Ga0068864_10009442233300005618Switchgrass RhizosphereVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0068866_1031294013300005718Miscanthus RhizosphereMVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP*
Ga0066903_10731357723300005764Tropical Forest SoilVATIGFGCWCLMVETTNRVRLDKFTRETWRKFDAKDLEPLKWAIIRRRRVLAFQAWP*
Ga0068851_1098106013300005834Corn RhizosphereMVETMDRVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP*
Ga0068863_10209627423300005841Switchgrass RhizosphereMVATMDRVRLDRFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP*
Ga0068863_10254074713300005841Switchgrass RhizosphereMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPV
Ga0079222_1051127513300006755Agricultural SoilMNRVRLDKFTRETWRKFDAKDLEPLEWAILRGRRVLAMQLRP*
Ga0079221_1072659213300006804Agricultural SoilVECWVLMVASMDRLTLDQFTRRIWRKFDPKDLEPLKWAILRRRRLLSCAMRP*
Ga0075421_10060027333300006845Populus RhizosphereVVECWCLMVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP*
Ga0075431_10006162133300006847Populus RhizosphereMVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP*
Ga0075434_10066605313300006871Populus RhizosphereLILMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP*
Ga0105245_1086012013300009098Miscanthus RhizosphereMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRVLAMQLRP*
Ga0075418_10022931103300009100Populus RhizosphereMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRILAMQLWP*
Ga0075418_1037056013300009100Populus RhizosphereMVEAMDRVRLDKFTRETWRKFDAKDFEPLKWAILRRRRVLAMRPWP*
Ga0105243_1192831413300009148Miscanthus RhizosphereWCLMVGTMDRVRLDKFTRETWRKFDAKDLEPLKWAILRRRRVLACPVRP*
Ga0111538_1013254933300009156Populus RhizosphereMVEAMDRVRLDKFTRETWRKFDVKDFEPLKWAILRRRRVLAMRPWP*
Ga0105241_1188058213300009174Corn RhizosphereMVATMDRVRLDRFTRETWKTFDAKDLEPLKWVILRRRRVLAAPMRP*
Ga0105242_1015907313300009176Miscanthus RhizosphereMVATMDGVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP*
Ga0105248_1159968323300009177Switchgrass RhizosphereMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP*
Ga0105238_1028030623300009551Corn RhizosphereVVECGILMVGTMDRVRLDRFTRETWRKFDAKDLEPLKATILERRRALAAPVRP*
Ga0105238_1142261723300009551Corn RhizosphereMVATMDRVRLDKFTRDTWKKFDTKDLETLKWAIILRRRMLACSSAR*
Ga0105249_1030121623300009553Switchgrass RhizosphereMVETMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRLLALQLRP*
Ga0105249_1067120633300009553Switchgrass RhizosphereMNRVRLDKFTPETWGKFDAKDLEPVKRAIIRKRRVLA*
Ga0134124_1150996713300010397Terrestrial SoilMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRILACPMRP*
Ga0138513_10008100523300011000SoilMVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQAWP*
Ga0105246_1259305023300011119Miscanthus RhizosphereRLDKFTRETWKKFDAKDLEPLKAAILRRRQVLAAPVRT*
Ga0150985_10952663133300012212Avena Fatua RhizosphereMVETMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARQLRP*
Ga0164298_1060176113300012955SoilPPIVIECWCLMVATMNRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP*
Ga0164299_1070755533300012958SoilMVETMNRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLTMQLWP*
Ga0164301_1079393013300012960SoilMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP*
Ga0164308_1159559313300012985SoilMVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLTMQLWP*
Ga0164304_1023576633300012986SoilMVATMDRVRLDRFTRETRRKFDAKDLEPLKWAILRRRRVLAMQLWP*
Ga0164306_1129741113300012988SoilILMVAMMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP*
Ga0164305_1006747823300012989SoilMVETMNRVRLDKFTRESWKNFDAKDLEPLKWAILRRRRVLTMQLWP*
Ga0157371_1026435023300013102Corn RhizosphereVVEHWCLMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP*
Ga0157374_1077260723300013296Miscanthus RhizosphereWCLMVPAMDRVRLDKFTRETWRKFAPADLEPLKAAILRRRRVLAAPVRMLPVATLR*
Ga0157378_1024084623300013297Miscanthus RhizosphereMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALHAWP*
Ga0163162_1154647923300013306Switchgrass RhizosphereMVATRTRVRLDRFTRDTWRKFDAQDLEPLKWAIIPRRRILAMQAASPP*
Ga0163163_1270324423300014325Switchgrass RhizosphereDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP*
Ga0157377_1008638323300014745Miscanthus RhizosphereMDRVRLDRFTRETWRKFDEKDLEPLKAASIRRRRVLACPVRP*
Ga0182005_113311313300015265RhizosphereMVATSDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP*
Ga0132258_1007008513300015371Arabidopsis RhizosphereMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRLLARQAWP*
Ga0132258_1152722833300015371Arabidopsis RhizosphereMVERMGRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRALACPVRP*
Ga0132258_1264736633300015371Arabidopsis RhizosphereMVETMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAMQLRP*
Ga0132256_10002504943300015372Arabidopsis RhizosphereMVATMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRVLARQAWP*
Ga0132256_10100988923300015372Arabidopsis RhizosphereVVVECFILMVATMDRARLDRFTRRTWRKHDARDLEPLKWAILRRRRLLAMQLWP*
Ga0132255_10204087313300015374Arabidopsis RhizosphereWISMVADMDRVRLDRFARETWKKFDAKDLEPLKWAILRRRRVLAAPMRP*
Ga0132255_10524051813300015374Arabidopsis RhizosphereDRVRLDKFTREMWKKFDARDLEPLEWAIIRRRRILAMQLRP*
Ga0247795_107536123300022899SoilMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP
Ga0207642_1033250913300025899Miscanthus RhizosphereMVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP
Ga0207657_1015578023300025919Corn RhizosphereMVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP
Ga0207657_1040856123300025919Corn RhizosphereMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP
Ga0207649_1104939813300025920Corn RhizosphereILMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP
Ga0207681_1071326413300025923Switchgrass RhizosphereVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP
Ga0207650_1004409133300025925Switchgrass RhizosphereMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP
Ga0207701_1000002983300025930Corn, Switchgrass And Miscanthus RhizosphereMNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVLTCPERP
Ga0207706_1002532033300025933Corn RhizosphereMNRVRLDKFAPETWGKFDAKDLEPVKRAIIRRRRVLA
Ga0207670_1163923723300025936Switchgrass RhizosphereMVETMDRVRLDSFTRETWKKFDAKDLEPLKWAILRRRRVLACPMRP
Ga0207691_1002958923300025940Miscanthus RhizosphereMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP
Ga0207661_1007338113300025944Corn RhizosphereDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP
Ga0207661_1026433013300025944Corn RhizosphereMDRVRLDKFTRETWRKFDPADLEPLKAAILRHRRVLAAPVRMLPVATLR
Ga0207708_1040202523300026075Corn, Switchgrass And Miscanthus RhizosphereMVETMNRVRLDRFTRETWRKFDAKDLELFKWAILRRRRVLAMQLP
Ga0207702_1031553313300026078Corn RhizosphereMVATMDHVRLDRFTRETWKKFDAKDLEPLKWAILRRRRALTMQL
Ga0207702_1090063513300026078Corn RhizosphereMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALHAWP
Ga0207641_1026323313300026088Switchgrass RhizosphereMVPAMDRVRLDKFTRETWRKFDPADLEPLKAAILRHRRVLAAPVRMLPVAT
Ga0207676_1009189933300026095Switchgrass RhizospherePAPPVVVECWCLMVATSDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP
Ga0207674_1059336323300026116Corn RhizosphereMVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAVGCPVRP
Ga0207698_1087618633300026142Corn RhizospherePPVVVECWCLLVETMDRVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP
Ga0209382_1029064323300027909Populus RhizosphereMVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP
Ga0268265_1186338323300028380Switchgrass RhizosphereNRVRLDRFTRETWRKFDAKDLEPFKWAILGRRRVLAMQLP
Ga0268264_1146637523300028381Switchgrass RhizosphereAIMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRLLALQLRP
Ga0310888_1006608613300031538SoilMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLACPMRP
Ga0310813_1038978223300031716SoilMVPAMDRVRLDKFTRETWRKFDPADLEPLKAAILRRRRVLAAPVRMLPVATLR
Ga0310893_1012672023300031892SoilLMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLACPMRP
Ga0310900_1008760713300031908SoilMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRILACPMRP
Ga0310900_1149905113300031908SoilMVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP
Ga0310906_1100846123300032013SoilMVADMDRVRLDRFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP
Ga0310890_1179235213300032075SoilMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.