NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095292

Metagenome / Metatranscriptome Family F095292

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095292
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 39 residues
Representative Sequence TAAGAKVFAAGALNFGASVGDPVVARLLENVWARLSRP
Number of Associated Samples 90
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 97.14 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.524 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.97%    β-sheet: 0.00%    Coil/Unstructured: 53.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF027373HCDH_N 45.71
PF007253HCDH 14.29
PF02803Thiolase_C 3.81
PF01370Epimerase 2.86
PF00561Abhydrolase_1 2.86
PF08241Methyltransf_11 1.90
PF00484Pro_CA 1.90
PF00106adh_short 0.95
PF02541Ppx-GppA 0.95
PF00082Peptidase_S8 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 60.00
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 45.71
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 45.71
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 45.71
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 45.71
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 45.71
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 45.71
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 3.81
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 1.90
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 1.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.52 %
UnclassifiedrootN/A10.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig144340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
2140918013|NODE_8250_length_1129_cov_4.449956All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300001978|JGI24747J21853_1002893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1446Open in IMG/M
3300002244|JGI24742J22300_10006037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1996Open in IMG/M
3300004081|Ga0063454_100117378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1319Open in IMG/M
3300005093|Ga0062594_100092856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1767Open in IMG/M
3300005328|Ga0070676_11280867All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300005435|Ga0070714_100884441All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300005445|Ga0070708_100288030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1546Open in IMG/M
3300005544|Ga0070686_100484868All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005552|Ga0066701_10912986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300005558|Ga0066698_10110381All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300005558|Ga0066698_10348956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300005568|Ga0066703_10848973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300005764|Ga0066903_104786160All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300006755|Ga0079222_11332298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales657Open in IMG/M
3300006791|Ga0066653_10321038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300006854|Ga0075425_100548668All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300006854|Ga0075425_102300136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300006854|Ga0075425_103138561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300006953|Ga0074063_13590144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1899Open in IMG/M
3300009012|Ga0066710_101885338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300009012|Ga0066710_103911327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300009093|Ga0105240_11523011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300009137|Ga0066709_102743670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300009137|Ga0066709_103120221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300009156|Ga0111538_11441422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300009156|Ga0111538_11510754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300009162|Ga0075423_12198487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300009545|Ga0105237_12544468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300010039|Ga0126309_10484602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300010039|Ga0126309_11252187Not Available512Open in IMG/M
3300010166|Ga0126306_10932240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300010321|Ga0134067_10274427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300010326|Ga0134065_10420888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300010333|Ga0134080_10174344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300010333|Ga0134080_10499815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300010333|Ga0134080_10549094Not Available555Open in IMG/M
3300010333|Ga0134080_10600543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300010373|Ga0134128_12720586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300010399|Ga0134127_13105567Not Available542Open in IMG/M
3300010400|Ga0134122_13036995Not Available524Open in IMG/M
3300010401|Ga0134121_10914037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300012001|Ga0120167_1006694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3618Open in IMG/M
3300012200|Ga0137382_10191639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1402Open in IMG/M
3300012201|Ga0137365_11121840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300012285|Ga0137370_10273222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300012354|Ga0137366_10156678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1712Open in IMG/M
3300012355|Ga0137369_10818239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300012355|Ga0137369_11133746Not Available508Open in IMG/M
3300012356|Ga0137371_10343982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300012356|Ga0137371_11043825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300012473|Ga0157340_1019575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300012503|Ga0157313_1028342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300012907|Ga0157283_10301251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012912|Ga0157306_10179403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300012915|Ga0157302_10540046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300012948|Ga0126375_10619737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300013105|Ga0157369_11393839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300013297|Ga0157378_10271844All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300014497|Ga0182008_10922090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300014969|Ga0157376_10649083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300015209|Ga0167629_1042071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1569Open in IMG/M
3300018054|Ga0184621_10032695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1670Open in IMG/M
3300018066|Ga0184617_1096781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300018071|Ga0184618_10081402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1239Open in IMG/M
3300018072|Ga0184635_10150855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300018465|Ga0190269_10411224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300018466|Ga0190268_11141370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300018468|Ga0066662_12277787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300018482|Ga0066669_10498613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300018482|Ga0066669_12092435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300019269|Ga0184644_1610147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300021073|Ga0210378_10095402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300022694|Ga0222623_10226798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300022898|Ga0247745_1035727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300022898|Ga0247745_1037445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300025911|Ga0207654_10310079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300025913|Ga0207695_10895474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300025922|Ga0207646_10401040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1238Open in IMG/M
3300025925|Ga0207650_11552849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300025927|Ga0207687_11192683Not Available654Open in IMG/M
3300025949|Ga0207667_11643959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300025996|Ga0208777_1018875Not Available590Open in IMG/M
3300026078|Ga0207702_10456715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300026529|Ga0209806_1317042Not Available523Open in IMG/M
3300027907|Ga0207428_10111034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2110Open in IMG/M
3300028707|Ga0307291_1039888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1116Open in IMG/M
3300028711|Ga0307293_10040639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1429Open in IMG/M
3300028712|Ga0307285_10150950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300028715|Ga0307313_10164046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300028716|Ga0307311_10128254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300028719|Ga0307301_10027307All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300028782|Ga0307306_10207518Not Available563Open in IMG/M
3300028782|Ga0307306_10271625Not Available501Open in IMG/M
3300028791|Ga0307290_10188046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300028793|Ga0307299_10081457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300028799|Ga0307284_10194383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300028807|Ga0307305_10348475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300028824|Ga0307310_10117991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M
3300028876|Ga0307286_10285578Not Available608Open in IMG/M
3300028881|Ga0307277_10029367All Organisms → cellular organisms → Bacteria2182Open in IMG/M
3300028884|Ga0307308_10229781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300033407|Ga0214472_11422305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300033550|Ga0247829_10356104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.86%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.95%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025996Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_007657902124908041SoilPQGAKVFAAGTLDFAASLDRPDVSRLVDNVWARLATP
Iowa-Corn-GraphCirc_033930102140918013SoilYYETPAGAKVFAAGALNFAASVDQPVVSQLLENLWGRLSLP
JGI24747J21853_100289343300001978Corn, Switchgrass And Miscanthus RhizosphereYETPSGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP*
JGI24742J22300_1000603743300002244Corn, Switchgrass And Miscanthus RhizospherePSGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP*
Ga0063454_10011737813300004081SoilETARGARVFAAGTLDFAASLDDPAVARLVENVWARLSRP*
Ga0062594_10009285613300005093SoilETPAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSAP*
Ga0070676_1128086713300005328Miscanthus RhizosphereMTYYETPAGAKVFAAGVLNFAASIDDPQVTRLVDNVWRKLSGAA*
Ga0070714_10088444133300005435Agricultural SoilETPAGAKVFAAGVINFGASLQDPAVERLLANVWARLIVP*
Ga0070708_10028803013300005445Corn, Switchgrass And Miscanthus RhizosphereYYETLAGAKVFAAGTLDFAASLDTAVVSRLVDNVWARLAAP*
Ga0070686_10048486823300005544Switchgrass RhizosphereYESASGARVFAAGTLDFTASITDPAVSQLVQNVWTRLAR*
Ga0066701_1091298613300005552SoilTPAGAKVFAAGALNFAASIGDPTVSQLVGNVWSRLSRP*
Ga0066698_1011038113300005558SoilAGAKVFAAGALNFAASVDDPVVARLLDNVWARLTRP*
Ga0066698_1034895623300005558SoilAGAKVFAAGALNFASSIGDATVAQLVENVWARLSRP*
Ga0066703_1084897323300005568SoilAKVFAAGALNFGASVDDPVVARLLENVWARLSRP*
Ga0066903_10478616033300005764Tropical Forest SoilPAGAKVFAAGALDFAASIDDPSVSRLVANLWDRLSQP*
Ga0079222_1133229833300006755Agricultural SoilGAKVFAAGVINFGASLGEPAVDRLLTNVWSRLAVP*
Ga0066653_1032103813300006791SoilTYYETAAGARVFAAGALNFGASVGDPVVARILDNVWTRLSTP*
Ga0075425_10054866833300006854Populus RhizosphereYETNAGARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR*
Ga0075425_10230013623300006854Populus RhizosphereYETPSGAKVFAAGALNFTASIGDPAVAQLVENVWTRLSRP*
Ga0075425_10313856113300006854Populus RhizosphereAKVFAAGALNFAASLDDPAVARLVDNVWSHLSVP*
Ga0074063_1359014413300006953SoilGSGARVFAAGALNFGASITDPAVSRLVENVWARLAR*
Ga0066710_10188533813300009012Grasslands SoilLGPGRSAEMTHYETPAGAKVFAPRALTFASSLGQPVVDRLLANVWARLTIP
Ga0066710_10391132713300009012Grasslands SoilETPAGAKVFATGTLDFAASLDRPDVSRLVDDIWARLSAP
Ga0105240_1152301123300009093Corn RhizosphereYESASGARVFAAGALNFAASITDPAVSRLVENVWARLAR*
Ga0066709_10274367023300009137Grasslands SoilYETPAGAKVFAAGTLDFAASLGNPVVSRLVDNVWTRLAMP*
Ga0066709_10312022123300009137Grasslands SoilTPAGAKVFAAGAIDFAASLGVPAVSRLVDNVWARFTAP*
Ga0111538_1144142223300009156Populus RhizosphereAKVFAAGALNFAASIGDPEVAQLVENLWTRLSVP*
Ga0111538_1151075433300009156Populus RhizosphereETPAGAKVFAAGSLNFGASLGRPEVDRLLSNMWTRLSVP*
Ga0075423_1219848733300009162Populus RhizosphereYESPAGAKVFAAGTLNFAASLDRPDVSRLVDNVWARLSAP*
Ga0105237_1254446823300009545Corn RhizosphereAGAKVFAAGALNFGASVGDPVVTRILDNLWARLSRP*
Ga0126309_1048460223300010039Serpentine SoilTYYETPAGARVFAAGVVNFGASITDPPVSRLIENVWSRLAR*
Ga0126309_1125218723300010039Serpentine SoilGGKVFAAGALNFAATLDRADVSRLVDNVWRRLASP*
Ga0126306_1093224013300010166Serpentine SoilGAKVFAAGSLNFGASLGRPEVDRLLANVWARLGVP*
Ga0134067_1027442723300010321Grasslands SoilYYETPRGAKVFAAGALNFAASADVPAVSQLLENVWARLSRP*
Ga0134065_1042088813300010326Grasslands SoilAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP*
Ga0134080_1017434413300010333Grasslands SoilYYETPAGAKVFAAGALNFAASLGRPDVARLVENVWTRLSAP*
Ga0134080_1049981523300010333Grasslands SoilLYRTPAGARVFAAGAIDFAASIGLPAVSRLVDNIWARFTAP*
Ga0134080_1054909423300010333Grasslands SoilLPRGAKVFAAGALNFGGSMADPAVARLVGNVWDRLSQP*
Ga0134080_1060054313300010333Grasslands SoilAPSGARVFAAGTIDFAASLGVPAVARLVDNVWARFAAPQ*
Ga0134128_1272058633300010373Terrestrial SoilGAKVFAAGALNFGASLGSPDVERLLANVWTRLTVP*
Ga0134127_1310556713300010399Terrestrial SoilAAGAKVFAAGVLNFAASLGRPEVDRLLANVWARLSAP*
Ga0134122_1303699523300010400Terrestrial SoilAAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSVP*
Ga0134121_1091403733300010401Terrestrial SoilAGAKVFAAGVINFGASLQDPAVEPLLANVWARLIVP*
Ga0120167_100669463300012001PermafrostRITRRRRGAKVFAAGALNFGASLGRPEVDRLLANVWARLSVP*
Ga0137382_1019163943300012200Vadose Zone SoilTYYETPTGAKVFAAGALNFGASLGRPQVDRLLANVWARLSVP*
Ga0137365_1112184023300012201Vadose Zone SoilAAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP*
Ga0137370_1027322213300012285Vadose Zone SoilTAAGAKVFAAGALNFGASVGDPVVARLLENVWARLSRP*
Ga0137366_1015667843300012354Vadose Zone SoilGAKVFAAGTLDFAASLDTPVVSRLVDNVWARLAAP*
Ga0137369_1081823933300012355Vadose Zone SoilYETPAGAKVFAAGSLNFSASLGRPEVERLLANVWARLSTP*
Ga0137369_1113374613300012355Vadose Zone SoilRSAEMTYYETAGSAKVFAAGTLNFAASLDRPDVSLLVDAVWAQLSVP*
Ga0137371_1034398223300012356Vadose Zone SoilEMTYYQTRAGAKIFSAGTINFGGSTQWPIAARLLDNLWARLSRP*
Ga0137371_1104382513300012356Vadose Zone SoilTAAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP*
Ga0157340_101957523300012473Arabidopsis RhizosphereTGSGARVFAAGVVNFVASINDPAVSRLVDNVWSRLAR*
Ga0157313_102834213300012503Arabidopsis RhizosphereTNAGARVFAAGVVNFAASINNPAVSRLVDNVWLRLAR*
Ga0157283_1030125123300012907SoilGAEVFAAGTLDFAASLDDPAVARLVENVWARLSKP*
Ga0157306_1017940323300012912SoilGARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR*
Ga0157302_1054004613300012915SoilPGGAKVFAAGALNFTASIGDPTVAQLVQNVWTRLSRP*
Ga0126375_1061973723300012948Tropical Forest SoilAGARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR*
Ga0157369_1139383913300013105Corn RhizosphereTGSGARVFAAGALDFAASITDPAVSRLVDNVWSRLAP*
Ga0157378_1027184413300013297Miscanthus RhizosphereEMTYYEGGSGARVFAAGALDFTASITDPTVSRLVDNVWSRLAG*
Ga0182008_1092209013300014497RhizosphereAGAKVFAAGVINFGASLADAQVDRLLENLWSRLAVP*
Ga0157376_1064908313300014969Miscanthus RhizosphereYESASGARVFAAGALNFAASIGDPEVAQLVENVWTRLSVP*
Ga0167629_104207143300015209Glacier Forefield SoilGAKVFAAGALNFGASLGLPEVERLLANVWARLSLP*
Ga0184621_1003269513300018054Groundwater SedimentETPAGAKVFAAGVINFGASLGDTAVDRLLANLWARLTVP
Ga0184617_109678123300018066Groundwater SedimentYETPAGAKVFAAGSLNFAASIGEPVVAQLVENLWTRLSGP
Ga0184618_1008140233300018071Groundwater SedimentGAKVFAAGALNFGASLGRPEVDRLLANVWTRLSVP
Ga0184635_1015085513300018072Groundwater SedimentYYETPGGAKVFAAGALNFTASIGDPTVSQLVENVWTRLSVP
Ga0190269_1041122413300018465SoilAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP
Ga0190268_1114137033300018466SoilTYYETPAGAKVFAAGVLNFAASIDDPHVSRLVDNVWARLSRPA
Ga0066662_1227778713300018468Grasslands SoilTYYETPAGAKVFAAGALDFAASLDQPAVSRLVENLWTRLARP
Ga0066669_1049861313300018482Grasslands SoilQRGAKLFAGGALNFAVSVTQPAVAQLLNNVWARLSRP
Ga0066669_1209243523300018482Grasslands SoilETAAGAKVFAAGALNFAASVDDPVVARLLDNVWARLTRP
Ga0184644_161014713300019269Groundwater SedimentAGAKVFAAGALNFAASLGRPEVDRLLANVWARLGVP
Ga0210378_1009540233300021073Groundwater SedimentTPHGAKVFAAGALNFTASIGEPFVSQLVENVWARLSRP
Ga0222623_1022679823300022694Groundwater SedimentTPAGARVFAAGVVDFAASINDPAVSRLVENVWSRLTAR
Ga0247745_103572713300022898SoilMTYYQRRGAKVFAAGTLNFAASIGNPTVAQLVENVWARLSQP
Ga0247745_103744523300022898SoilSAGAKVFAAGALNFAASVDQPVVSQLLENLWGRLSLP
Ga0207654_1031007933300025911Corn RhizosphereSGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP
Ga0207695_1089547423300025913Corn RhizosphereYESASGARVFAAGALNFAASITDPAVSRLVENVWARLAR
Ga0207646_1040104023300025922Corn, Switchgrass And Miscanthus RhizosphereYYETPAGAKVFAAGALNFAASVDDPVVARLLDNVWARLSRP
Ga0207650_1155284913300025925Switchgrass RhizosphereAGAKVFAAGVLNFAASIDDPQVSRLVDNVWTRLSRST
Ga0207687_1119268313300025927Miscanthus RhizosphereTPEGAKVFAAGAINFGASLADPAVDRLLSNVWARLTVP
Ga0207667_1164395913300025949Corn RhizosphereYYESTSGARVFAAGALNFAASITDPAVSRLVENVWARLAR
Ga0208777_101887523300025996Rice Paddy SoilETGSGARVFAAGALNFTASITDPAVSRLVENVWSRLAR
Ga0207702_1045671533300026078Corn RhizosphereSPSGARVFAAGTLDFTASITDPAVSQLVQNVWTRLAR
Ga0209806_131704223300026529SoilGAKVFAAGALNFAASLGNEQVARLVENVWNKLTVP
Ga0207428_1011103413300027907Populus RhizosphereYYETPAGARVFSAGAVNFAASIRDPAVSRLVENVWARLLGR
Ga0307291_103988813300028707SoilEADSGARVFAAGALNFTASITDPAVSPLVENVWARLAR
Ga0307293_1004063913300028711SoilYETPAGARVFAAGALNFAASIGDPKVSQLVENVWTRLSRP
Ga0307285_1015095013300028712SoilYETAAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP
Ga0307313_1016404623300028715SoilGARVFAAGVVNFAASITDPAVSQLVDNVWSRLTEP
Ga0307311_1012825423300028716SoilSGARVFAAGALNFTASITDPAVSRLVENVWARLAR
Ga0307301_1002730713300028719SoilYETEAGARVFAAGVVNFAASITDPAVSQLVDNVWSRLTEP
Ga0307306_1020751813300028782SoilTAAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSIP
Ga0307306_1027162513300028782SoilPAGAKVFAAGVINFGASLGDTAVDRLLANLWARLTVP
Ga0307290_1018804623300028791SoilEGPAGARVFAAGVLNFAASITDPSVSRLVDNVWSRLVR
Ga0307299_1008145723300028793SoilAGARVFAAGVVDFAASINDPAVSRLVENVWSRLTAR
Ga0307284_1019438313300028799SoilPAGARVFAAGALNFAASIGDPKVSQLVENVWTRLSRP
Ga0307305_1034847533300028807SoilYETPAGAKVFAAGALNFGASLGQPEVDRLLANVWARLSVP
Ga0307310_1011799133300028824SoilYETPEGAKVFAAGVINFGASLAQPAVDRLLTNVWSRLTVP
Ga0307286_1028557813300028876SoilYYETPAGAKVFAAGALNFAASVDQPVVSQLLENLWASLSLP
Ga0307277_1002936713300028881SoilYYENPRGAKVFAAGALNFAASIDHPAVAQLLDNVWARLSRP
Ga0307308_1022978133300028884SoilPAGAKVFAAGALNFGASLGRPEVDRLLANVWARLSIP
Ga0214472_1142230513300033407SoilTYYETPAGAKVFAAGVLNFAASIDDPQVSRLVENVWARLASR
Ga0247829_1035610413300033550SoilYYETPVGAKVFAAGALNFTASIGDPAVEGLVENVWSRLSRP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.