NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095200

Metagenome / Metatranscriptome Family F095200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095200
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 53 residues
Representative Sequence VDLLSLNRHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Number of Associated Samples 87
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.048 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(53.333 % of family members)
Environment Ontology (ENVO) Unclassified
(67.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(59.048 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.35%    β-sheet: 0.00%    Coil/Unstructured: 87.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF01066CDP-OH_P_transf 89.52
PF00308Bac_DnaA 3.81
PF00300His_Phos_1 2.86
PF13090PP_kinase_C 0.95
PF10103Zincin_2 0.95
PF04932Wzy_C 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 89.52
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 89.52
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 89.52
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 3.81
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 3.81
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.05 %
UnclassifiedrootN/A0.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101762728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300005332|Ga0066388_105425810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088646Open in IMG/M
3300005536|Ga0070697_100222131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1610Open in IMG/M
3300005557|Ga0066704_10849167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088566Open in IMG/M
3300005559|Ga0066700_10207386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881356Open in IMG/M
3300006797|Ga0066659_10323672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1185Open in IMG/M
3300010046|Ga0126384_11511980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
3300010358|Ga0126370_11487872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300010362|Ga0126377_12209800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300010376|Ga0126381_103242953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300010376|Ga0126381_103792212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300010376|Ga0126381_104529853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300010398|Ga0126383_13300583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300012208|Ga0137376_10740332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300012361|Ga0137360_10045894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883123Open in IMG/M
3300012362|Ga0137361_11137056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300012917|Ga0137395_11058024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300012925|Ga0137419_10178706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1555Open in IMG/M
3300016270|Ga0182036_10375838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881101Open in IMG/M
3300016270|Ga0182036_10574327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria901Open in IMG/M
3300016319|Ga0182033_11986472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300016357|Ga0182032_10225643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881442Open in IMG/M
3300016371|Ga0182034_11508519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300016404|Ga0182037_10639239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria906Open in IMG/M
3300016422|Ga0182039_10557320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria997Open in IMG/M
3300016422|Ga0182039_11634685Not Available588Open in IMG/M
3300016445|Ga0182038_10326948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881262Open in IMG/M
3300020583|Ga0210401_11287494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300021372|Ga0213877_10068971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1041Open in IMG/M
3300021439|Ga0213879_10165108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300021476|Ga0187846_10036449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2210Open in IMG/M
3300025910|Ga0207684_10414409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1158Open in IMG/M
3300027603|Ga0209331_1035616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881274Open in IMG/M
3300027748|Ga0209689_1227251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria793Open in IMG/M
3300027824|Ga0209040_10479098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300030969|Ga0075394_11564550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales727Open in IMG/M
3300031057|Ga0170834_108151108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300031122|Ga0170822_10302847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300031231|Ga0170824_114699837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M
3300031469|Ga0170819_16972562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria675Open in IMG/M
3300031474|Ga0170818_101364706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300031545|Ga0318541_10539998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria652Open in IMG/M
3300031564|Ga0318573_10046445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882104Open in IMG/M
3300031573|Ga0310915_10697967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria716Open in IMG/M
3300031640|Ga0318555_10096566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881553Open in IMG/M
3300031668|Ga0318542_10008396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3790Open in IMG/M
3300031681|Ga0318572_10266962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1008Open in IMG/M
3300031681|Ga0318572_10745950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300031682|Ga0318560_10100152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881498Open in IMG/M
3300031713|Ga0318496_10751198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300031719|Ga0306917_11301251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300031724|Ga0318500_10031609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882128Open in IMG/M
3300031724|Ga0318500_10136179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881146Open in IMG/M
3300031747|Ga0318502_10169741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1252Open in IMG/M
3300031748|Ga0318492_10103251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881403Open in IMG/M
3300031768|Ga0318509_10678579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300031770|Ga0318521_10070585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1860Open in IMG/M
3300031770|Ga0318521_10415328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales803Open in IMG/M
3300031778|Ga0318498_10355012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300031781|Ga0318547_10204866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1179Open in IMG/M
3300031781|Ga0318547_11011467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300031782|Ga0318552_10702132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300031792|Ga0318529_10028929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882281Open in IMG/M
3300031792|Ga0318529_10220210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria882Open in IMG/M
3300031795|Ga0318557_10591761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300031796|Ga0318576_10361723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300031796|Ga0318576_10403299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300031805|Ga0318497_10273858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria938Open in IMG/M
3300031831|Ga0318564_10351841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300031833|Ga0310917_10884340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300031833|Ga0310917_11000016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300031879|Ga0306919_10230723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1387Open in IMG/M
3300031879|Ga0306919_10310480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881198Open in IMG/M
3300031880|Ga0318544_10068395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881308Open in IMG/M
3300031880|Ga0318544_10374989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300031897|Ga0318520_10477277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria768Open in IMG/M
3300031897|Ga0318520_10612595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300031910|Ga0306923_11459063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300031941|Ga0310912_10095743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882178Open in IMG/M
3300031942|Ga0310916_10047416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883266Open in IMG/M
3300031942|Ga0310916_11186900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300031945|Ga0310913_10031425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883383Open in IMG/M
3300031946|Ga0310910_11551064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300031947|Ga0310909_10277901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881401Open in IMG/M
3300031947|Ga0310909_10571593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria945Open in IMG/M
3300031954|Ga0306926_10316633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1931Open in IMG/M
3300031954|Ga0306926_11786808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300031959|Ga0318530_10090840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881205Open in IMG/M
3300032001|Ga0306922_10627953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881136Open in IMG/M
3300032041|Ga0318549_10064594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881541Open in IMG/M
3300032043|Ga0318556_10376238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300032054|Ga0318570_10133002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1105Open in IMG/M
3300032055|Ga0318575_10233590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales926Open in IMG/M
3300032060|Ga0318505_10039871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881966Open in IMG/M
3300032063|Ga0318504_10044259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1842Open in IMG/M
3300032066|Ga0318514_10578608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300032067|Ga0318524_10146111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881194Open in IMG/M
3300032068|Ga0318553_10141043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881245Open in IMG/M
3300032076|Ga0306924_12423270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300032091|Ga0318577_10338427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300032091|Ga0318577_10377897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300032180|Ga0307471_101790173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria766Open in IMG/M
3300032205|Ga0307472_100022476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883488Open in IMG/M
3300033289|Ga0310914_10302915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1441Open in IMG/M
3300033290|Ga0318519_10293389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria950Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil53.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.81%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10176272823300002245Forest SoilLSRQEAKIQIRYTGSADQLKSSLAEVDLGLGGGDPIWVLQVSGTASSR*
Ga0066388_10542581013300005332Tropical Forest SoilDRLASVMAIRKVDLLSLNRQEAKVQIKYIGSSEQLKSSLAEVDLDLGGGDPLWRLQRSSATSSR*
Ga0070697_10022213113300005536Corn, Switchgrass And Miscanthus RhizosphereLLSLSRQEAKIQIRYVGSAEQLKSSLADVDLGLGGTDPMWQLQISSATGSR*
Ga0066704_1084916713300005557SoilMVRDRLASAAAVRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSATGSR*
Ga0066700_1020738613300005559SoilDWVMVRDRLASAAAVRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSATGSR*
Ga0066659_1032367233300006797SoilSRQEAKIQIRYVGSADQLKSSLAEVDLGLGGGDPVWVLQVAGTGGSR*
Ga0126384_1151198013300010046Tropical Forest SoilQIKYVGGADQLKSSLAGVDLGLAGTDPEWRLQLSGMAGVH*
Ga0126370_1148787223300010358Tropical Forest SoilSLNRHEAKIQINYVGGPDQLKSSLAGVDLGLDGTDPIWRLQLSGAAGPH*
Ga0126377_1220980023300010362Tropical Forest SoilLSLNRHEAKIQIKYIGGSDELKSSLAAVDLGLDGTDPAWRLQLSGTRDSR*
Ga0126381_10324295313300010376Tropical Forest SoilNRHEAKIQIRYIGGSDQLKSSLAAVDLGLDGTDPVWQLQLSGGR*
Ga0126381_10379221223300010376Tropical Forest SoilAKIQIKYVGSPEQLRSSLAEVDLGLDGTDPLWRLQLSGATGAH*
Ga0126381_10452985323300010376Tropical Forest SoilVDLLSLNRHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR*
Ga0126383_1330058323300010398Tropical Forest SoilDRLASVPVIRKVDLLSLSRHEAKIQIRYIGGSDQLKSSLAAVDLGLDGTDPVWQLQLSGGR*
Ga0137376_1074033213300012208Vadose Zone SoilSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSATGSR*
Ga0137360_1004589413300012361Vadose Zone SoilVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPVWQLQISSAAGSR*
Ga0137361_1113705623300012362Vadose Zone SoilDLLSLSRQEAKIQIRYIGSADQLKSSLAEVDLGLGGGDPIWVLQVSGTASSR*
Ga0137395_1105802423300012917Vadose Zone SoilSDWVMVRDRLASAAAVRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSATGSR*
Ga0137419_1017870613300012925Vadose Zone SoilRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGADPVWQLQISSATGSR*
Ga0182036_1037583813300016270SoilDLLSLNRHEAKIQIKYVGSSDQLRSGLAGVDLGLDGTGPVWRLQLSGTAGAQ
Ga0182036_1057432723300016270SoilLLSLNRHEAKIQIRYVGGSDQLKSSLAAVDLGLDGADPVWRLQLSGIAGSR
Ga0182033_1198647213300016319SoilAIRKVDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGLDGTDPIWRLQLSGATGAH
Ga0182032_1022564313300016357SoilRLASVPTIRKVDLLSLNRHEAKIQIKYVGGSDELKSSLAAVDLGLDGTDPAWRLQLSGTRDSR
Ga0182034_1150851913300016371SoilNRHEAKLQIMYFGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0182037_1063923913300016404SoilRDRLTTVPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAAVDLGLDGTDPV
Ga0182039_1055732033300016422SoilREAKIQIKYVGGPDQLRSSLAGVDLGLDGNDPIWRLQLSGATGPR
Ga0182039_1163468513300016422SoilQIRYVGGTDQLKSSLGEVDLGLNGTDPAWRLQLSGATGAH
Ga0182038_1032694833300016445SoilPAIRKVDLLSLNRHEVKLQIKYVGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0210401_1128749423300020583SoilRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPVWQLQISSATGSR
Ga0213877_1006897113300021372Bulk SoilDLLSLNRHEAKIQIKYVGSFDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0213879_1016510823300021439Bulk SoilQEARIQLRYVGSSDQLRSSLAEVDLDLGGGDPVWRLQRSGPPSLH
Ga0187846_1003644943300021476BiofilmVQVRDRLASVSAVRKVDLLSLNRQEAKIQVRYVGSPDQLRSSLAEVHLDLGGGDPVWRLQRSGAASSR
Ga0207684_1041440913300025910Corn, Switchgrass And Miscanthus RhizosphereASAAAVRRIDLLSLSRQEAKIQIRYVGSAEQLKSSLADVDLGLGGTDPMWQLQISSATGS
Ga0209331_103561613300027603Forest SoilSRQEAKIQIRYTGSADQLKSSLAEVDLGLGGGDPIWVLQVSGTASSR
Ga0209689_122725123300027748SoilDWVMVRDRLASAAAVRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSATGSR
Ga0209040_1047909813300027824Bog Forest SoilQIKYVGSPEQLRASLAEVDLDLGGSDPLWRLQRSAATNSP
Ga0075394_1156455023300030969SoilEWVSVRDRLASVPTIRKVDLLSLNRHEAKIQIKYVGGSDELKSSLAAVDLGLDGTDPVWRLQLSGTTGGR
Ga0170834_10815110823300031057Forest SoilLNRHEAKIQIKYVGGSDELKSSLAAVDLGLDGIDPVWRLRLSGTGDSR
Ga0170822_1030284723300031122Forest SoilVMVRDRLASAAAVRRVDLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPMWQLQISSAAGSR
Ga0170824_11469983723300031231Forest SoilLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGTDPLWQLRISSATGSR
Ga0170819_1697256213300031469Forest SoilDLLSLNRHEAKIQIKYVGGSDQLKSSLAAVDLGLDGTDPVWRLQLSGTAGSR
Ga0170818_10136470623300031474Forest SoilTTVPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAAVDLGLDGADPVWRLQLSGTAGS
Ga0318541_1053999823300031545SoilRDRLASVGAIRKVDLLSLNRREAKIQIKYVGGPDQLRSSLAGVDLGLDGNDPIWRLQLSGATGPR
Ga0318573_1004644543300031564SoilLNRHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0310915_1069796723300031573SoilIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318555_1009656613300031640SoilIQIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318542_1000839633300031668SoilVRVRDRLASVGAIRKVDLLSLNRREAKIQIKYVGGPDQLRSSLAGVDLGLDGNDPIWRLQLSGATGPR
Ga0318572_1026696233300031681SoilQIKYVGGPDQLRSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0318572_1074595023300031681SoilLSLNRHEAKIQIKYVGGADQLKSSLAGIDLGLAGTDPEWRLQLSGMAGAH
Ga0318560_1010015233300031682SoilDRLASVPAIRKVDLLSLNRHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAH
Ga0318496_1075119813300031713SoilVDLLSLNRREAKIQIKYVGGPDQLRSSLAGVDLGLDGNDPIWRLQLSGATGPR
Ga0306917_1130125113300031719SoilPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318500_1003160913300031724SoilAVRRVDLLSLNRHEAKIRIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318500_1013617913300031724SoilRDRLASVPAIRKVDLISLNRHEAKIQIKYVGGPDQLRSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0318502_1016974113300031747SoilVDLVSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVAGPH
Ga0318492_1010325133300031748SoilEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGATGVH
Ga0318509_1067857923300031768SoilYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318521_1007058543300031770SoilVRLRDRLASVPAIRKVDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGATGVH
Ga0318521_1041532813300031770SoilIGEWVRVRDRLASVPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGADPVWRLQLSGVTGPR
Ga0318498_1035501223300031778SoilLVSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVAGPH
Ga0318547_1020486613300031781SoilKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAH
Ga0318547_1101146723300031781SoilRLASVPAIRKVDLLSLNRHEAKIQIKYVGGADQLKSSLAGVDLGLAGTDPEWRLQLSGMAGAH
Ga0318552_1070213223300031782SoilHEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGAMGVH
Ga0318529_1002892943300031792SoilVRDRLASVPAIRKVDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGAMGVH
Ga0318529_1022021023300031792SoilKVDLLSLNRHEVKLQIKYVGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0318557_1059176123300031795SoilIKYFGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0318576_1036172313300031796SoilQIKYFGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0318576_1040329923300031796SoilRHEAKIQIKYVGGPDQLRSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0318497_1027385823300031805SoilVDLLSLNRHEAKLQIKYFGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0318564_1035184113300031831SoilLNRHEAKIRIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0310917_1088434013300031833SoilLLSLNRHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAH
Ga0310917_1100001623300031833SoilTTVPAIRKVDLLSLNRHEAKIQIRYVGGSDQLKSSLAGVDLGLDGADPVWRLQLSGIAGS
Ga0306919_1023072333300031879SoilAKIQIKYVGGPDQLRSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0306919_1031048033300031879SoilAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318544_1006839513300031880SoilPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGADPVWRLQLSGVTGPR
Ga0318544_1037498913300031880SoilLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVAGPH
Ga0318520_1047727723300031897SoilYVGGPDQLSSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0318520_1061259523300031897SoilVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0306923_1145906313300031910SoilIQIKYVGSSDQLRSGLAGVDLGLDGTDPVWRLQLSGTAGAQ
Ga0310912_1009574313300031941SoilHEVKLQIKYVGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0310916_1004741653300031942SoilGDWVRIRDRLALVPAIRKVDLLSLNRHEAKLQIKYFGGPDQLRSGLAGVDLGLDGADPEWRLQLSGVAGAR
Ga0310916_1118690023300031942SoilVRDRLASVPTIRKVDLLSLNRHEAKIQIKYVGGSDELKSSLAAVDLGLDGTDPAWRLQLSGTRDSR
Ga0310913_1003142553300031945SoilHEAKIQIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAH
Ga0310910_1155106413300031946SoilNRHEAKIQIKYVGSSDQLRSGLAGVDLGLDGTDPVWRLQLSGTAGAQ
Ga0310909_1027790113300031947SoilIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0310909_1057159323300031947SoilDRLASVPTIRKVDLLSLNRHEAKIQIKYVGGSDELKSSLAAVDLGLDGTDPAWRLQLSGTRDSR
Ga0306926_1031663343300031954SoilDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGLDGTDPIWRLQLSGAAGAH
Ga0306926_1178680813300031954SoilEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318530_1009084033300031959SoilRHEAKIRIKYVGSSDQLRSSLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0306922_1062795333300032001SoilLASVPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318549_1006459413300032041SoilIGEWVRVRDRLATVPAIRRVDLLSFNRHEARIQIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318556_1037623823300032043SoilNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318570_1013300213300032054SoilIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318575_1023359013300032055SoilVRDRLATVPAIRRVDLLSFNRHEARIQIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR
Ga0318505_1003987113300032060SoilATVPAIRRVDLLSFNRHEARIQIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGA
Ga0318504_1004425943300032063SoilDDDRLASVPAIRKVDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGATGVH
Ga0318514_1057860823300032066SoilGGPVQLRSSLAGVDLGLDGNDPIWRLQLSGATGPR
Ga0318524_1014611113300032067SoilRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVAGPH
Ga0318553_1014104313300032068SoilQAVRRVDLLSLNRHEAKIQIKYVGSSDQLRSSLAGVDLGLDGTDPIWRLQLSGATGAR
Ga0306924_1242327013300032076SoilAIRKVDLLSLNRHEAKIQIKYVGSSEQLRSSLAEVDLGVDGTDPIWRLQLSGAMGVH
Ga0318577_1033842723300032091SoilRDRLASVPAIRKVDLLSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGTDPVWRLQLSGVTGPR
Ga0318577_1037789723300032091SoilKVDLISLNRHEAKIQIKYVGGPDQLRSSLAGVDLGLDGADPEWRLQLSGVAGTR
Ga0307471_10179017323300032180Hardwood Forest SoilLLSLSRQEAKIQIRYVGSAEQLKSSLAEVDLGLGGSDPVWQLQISSATGSR
Ga0307472_10002247613300032205Hardwood Forest SoilPTIRKVDLLSLNRHEAKIQIRYVGGSDQLKSSLAAVDLGLDGTDPVWRLQLSGTTGGR
Ga0310914_1030291533300033289SoilSLNRHEAKIQIKYVGGSDQLKSSLAGVDLGLDGADPVWRLQLSGVTGPR
Ga0318519_1029338923300033290SoilLATVPAIRRVDLLSFNRHEARIQIKYVGSSDQLRSGLAEVDLGLDGTDPIWRLQLSGATGAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.