NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095180

Metagenome / Metatranscriptome Family F095180

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095180
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 45 residues
Representative Sequence HMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF
Number of Associated Samples 91
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.85 %
% of genes near scaffold ends (potentially truncated) 92.38 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.190 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(10.476 % of family members)
Environment Ontology (ENVO) Unclassified
(40.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.55%    β-sheet: 0.00%    Coil/Unstructured: 79.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00106adh_short 1.90
PF13561adh_short_C2 1.90
PF02518HATPase_c 1.90
PF12704MacB_PCD 1.90
PF02082Rrf2 1.90
PF07690MFS_1 1.90
PF04014MazE_antitoxin 1.90
PF13378MR_MLE_C 1.90
PF00072Response_reg 0.95
PF04255DUF433 0.95
PF07452CHRD 0.95
PF03551PadR 0.95
PF05222AlaDh_PNT_N 0.95
PF12680SnoaL_2 0.95
PF01035DNA_binding_1 0.95
PF13646HEAT_2 0.95
PF00174Oxidored_molyb 0.95
PF01738DLH 0.95
PF01575MaoC_dehydratas 0.95
PF08547CIA30 0.95
PF028262-Hacid_dh_C 0.95
PF14559TPR_19 0.95
PF03404Mo-co_dimer 0.95
PF13714PEP_mutase 0.95
PF02634FdhD-NarQ 0.95
PF00005ABC_tran 0.95
PF01850PIN 0.95
PF07969Amidohydro_3 0.95
PF13468Glyoxalase_3 0.95
PF12543DUF3738 0.95
PF02449Glyco_hydro_42 0.95
PF07589PEP-CTERM 0.95
PF06315AceK_kinase 0.95
PF07676PD40 0.95
PF13751DDE_Tnp_1_6 0.95
PF14534DUF4440 0.95
PF01148CTP_transf_1 0.95
PF13632Glyco_trans_2_3 0.95
PF10387DUF2442 0.95
PF02687FtsX 0.95
PF13505OMP_b-brl 0.95
PF00171Aldedh 0.95
PF10604Polyketide_cyc2 0.95
PF05685Uma2 0.95
PF09517RE_Eco29kI 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 1.90
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 1.90
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 1.90
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 1.90
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 1.90
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 1.90
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 1.90
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 1.90
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.95
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.95
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.95
COG1526Formate dehydrogenase assembly factor FdhD, a sulfurtransferaseEnergy production and conversion [C] 0.95
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.95
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.95
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.95
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.95
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.95
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.95
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.95
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.95
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.95
COG4579Isocitrate dehydrogenase kinase/phosphataseSignal transduction mechanisms [T] 0.95
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.19 %
UnclassifiedrootN/A3.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003298|Ga0006841J48915_113992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia577Open in IMG/M
3300004619|Ga0068953_1357549All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005332|Ga0066388_104498965All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300005355|Ga0070671_100637442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia922Open in IMG/M
3300006800|Ga0066660_11061387All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187645Open in IMG/M
3300009093|Ga0105240_10940839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales927Open in IMG/M
3300009177|Ga0105248_10173181All Organisms → cellular organisms → Bacteria → Acidobacteria2433Open in IMG/M
3300009635|Ga0116117_1120254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22665Open in IMG/M
3300009636|Ga0116112_1045520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31317Open in IMG/M
3300009700|Ga0116217_10127933All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300009759|Ga0116101_1168377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3545Open in IMG/M
3300010048|Ga0126373_11840230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3669Open in IMG/M
3300010358|Ga0126370_10009058All Organisms → cellular organisms → Bacteria5227Open in IMG/M
3300010361|Ga0126378_11967035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4666Open in IMG/M
3300010376|Ga0126381_102116357All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300010379|Ga0136449_101684593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3957Open in IMG/M
3300010379|Ga0136449_103705225All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300011045|Ga0138598_144855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3569Open in IMG/M
3300012210|Ga0137378_11364062All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300012212|Ga0150985_118225013All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012362|Ga0137361_11256369All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300013306|Ga0163162_11337919All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300014155|Ga0181524_10189305All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300014161|Ga0181529_10039941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3438Open in IMG/M
3300014164|Ga0181532_10038245All Organisms → cellular organisms → Bacteria3261Open in IMG/M
3300014167|Ga0181528_10018139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4113Open in IMG/M
3300014167|Ga0181528_10299750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3870Open in IMG/M
3300014199|Ga0181535_10328781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus907Open in IMG/M
3300014491|Ga0182014_10193607All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300014501|Ga0182024_12652338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3537Open in IMG/M
3300014657|Ga0181522_10237247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1077Open in IMG/M
3300014657|Ga0181522_10918317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3540Open in IMG/M
3300014838|Ga0182030_11131434All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300014838|Ga0182030_11371648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3591Open in IMG/M
3300015359|Ga0134085_10319562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli685Open in IMG/M
3300017925|Ga0187856_1266145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3600Open in IMG/M
3300017929|Ga0187849_1370086All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300017943|Ga0187819_10649704All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300017955|Ga0187817_10467610All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300018017|Ga0187872_10081156All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300018026|Ga0187857_10144154All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300018034|Ga0187863_10042298All Organisms → cellular organisms → Bacteria2632Open in IMG/M
3300018034|Ga0187863_10195404All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300018043|Ga0187887_10570553All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300018044|Ga0187890_10689203All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300018046|Ga0187851_10559953All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300018046|Ga0187851_10664956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3588Open in IMG/M
3300018058|Ga0187766_10177186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1336Open in IMG/M
3300018062|Ga0187784_10941199All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300018088|Ga0187771_11057878All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300019268|Ga0181514_1285339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3669Open in IMG/M
3300019278|Ga0187800_1135157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium715Open in IMG/M
3300019278|Ga0187800_1141951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3867Open in IMG/M
3300019278|Ga0187800_1563377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus655Open in IMG/M
3300021384|Ga0213876_10520256Not Available633Open in IMG/M
3300021384|Ga0213876_10633200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3569Open in IMG/M
3300021560|Ga0126371_11519768Not Available797Open in IMG/M
3300022709|Ga0222756_1081236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3530Open in IMG/M
3300022881|Ga0224545_1063575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3521Open in IMG/M
3300023090|Ga0224558_1189269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300023552|Ga0247551_105649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia524Open in IMG/M
3300025500|Ga0208686_1132712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium510Open in IMG/M
3300027825|Ga0209039_10362677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3560Open in IMG/M
3300027855|Ga0209693_10558172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3543Open in IMG/M
3300027869|Ga0209579_10404646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3740Open in IMG/M
3300027889|Ga0209380_10269417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1001Open in IMG/M
3300029914|Ga0311359_10619371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales794Open in IMG/M
3300029943|Ga0311340_11023857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium677Open in IMG/M
3300029951|Ga0311371_11070600All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300029951|Ga0311371_12290451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3559Open in IMG/M
3300029955|Ga0311342_10949099All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3644Open in IMG/M
3300029999|Ga0311339_11418477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3623Open in IMG/M
3300030730|Ga0307482_1192689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3616Open in IMG/M
3300030741|Ga0265459_14034606All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300031236|Ga0302324_100069457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6167Open in IMG/M
3300031236|Ga0302324_101200623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1011Open in IMG/M
3300031238|Ga0265332_10277290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3693Open in IMG/M
3300031261|Ga0302140_10070866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3660Open in IMG/M
3300031261|Ga0302140_10282456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31420Open in IMG/M
3300031474|Ga0170818_103731261All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031524|Ga0302320_11392860Not Available699Open in IMG/M
3300031525|Ga0302326_12206189All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300031545|Ga0318541_10873850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3502Open in IMG/M
3300031590|Ga0307483_1031648All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031708|Ga0310686_114627667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium580Open in IMG/M
3300031956|Ga0316032_107388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3555Open in IMG/M
3300032160|Ga0311301_11098141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1035Open in IMG/M
3300032515|Ga0348332_10354143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3635Open in IMG/M
3300032770|Ga0335085_11982970All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300032782|Ga0335082_10703841All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300032783|Ga0335079_10721593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761039Open in IMG/M
3300032783|Ga0335079_11607228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300032828|Ga0335080_10803822All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300032892|Ga0335081_12701912All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032893|Ga0335069_12494182All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300032897|Ga0335071_10948806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium807Open in IMG/M
3300032955|Ga0335076_11748198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium511Open in IMG/M
3300033134|Ga0335073_10514309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1363Open in IMG/M
3300033158|Ga0335077_11385225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300033402|Ga0326728_10620299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter836Open in IMG/M
3300033402|Ga0326728_11007961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus576Open in IMG/M
3300033755|Ga0371489_0061301All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300033983|Ga0371488_0194541All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300034195|Ga0370501_0382588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.62%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.81%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.86%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.86%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.90%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.95%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003298Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004619Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011045Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023552Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031956Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0006841J48915_11399223300003298Peatlands SoilVKFRIHEHVLLRVDFLDYITTFPKRQIMPAPNNTARGIFQQFTPLFGVSYTF*
Ga0068953_135754913300004619Peatlands SoilHMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF*
Ga0066388_10449896523300005332Tropical Forest SoilVRFRLRNNLLLRGEFLDYLTTFPRQQIAPAPHNTARGIFEQFTPLFGASYTF*
Ga0070671_10063744213300005355Switchgrass RhizosphereRAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVGYLF*
Ga0066660_1106138713300006800SoilMLLRAEFLDYLTTFPRQQIVPASHNTARRIFQQFTPLFGVGYTF
Ga0105240_1094083913300009093Corn RhizosphereNLLLRGEFRDHITTFPRQQIVPAPHNTARGIFEQFTPLFGVSYCF*
Ga0105248_1017318133300009177Switchgrass RhizosphereMLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVGYLF*
Ga0116117_112025423300009635PeatlandPHMLLRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGISYTFDSLRRH*
Ga0116112_104552013300009636PeatlandLLRAEFRDYLTTFPRQQIVPAVHNTARGVFEQFTPLFGVSYTF*
Ga0116217_1012793343300009700Peatlands SoilLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGLSYTFGHLF*
Ga0116101_116837723300009759PeatlandGGAKFRLLKQMEMRVEFRDYLTTFPRQQIVPAPHNTARGVFQQFTPLFGVVYVIQSRR*
Ga0126373_1184023013300010048Tropical Forest SoilKYRLIPHLLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGASYDFNWR*
Ga0126370_1000905853300010358Tropical Forest SoilVRFRLRNHLLLRGEFLDYLTTFPRQQIAPAPHNTARGIFEQFTPVFGASYTF*
Ga0126378_1196703513300010361Tropical Forest SoilLLRTQFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF*
Ga0126381_10211635723300010376Tropical Forest SoilFTTFPRTQFVPAPQATARGIFQQLTPLFGVSYTFQ*
Ga0136449_10168459313300010379Peatlands SoilVKFRLIPHMLLRAEFRDYLTTFPRQQIVPAPHNTARGVFEQFTPL
Ga0136449_10370522523300010379Peatlands SoilHMQLRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVAYTF*
Ga0138598_14485523300011045Peatlands SoilRIHEHVLLRVDFLDYITTFPKRQIMPAPNNTARGIFQQFTPLFGVSYTF*
Ga0137378_1136406213300012210Vadose Zone SoilMVLRSEFRDYITTFPRQQIVPAPHNTARGISEQFTPLFGVSYTF*
Ga0150985_11822501313300012212Avena Fatua RhizosphereEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVGYVF*
Ga0137361_1125636913300012362Vadose Zone SoilFRDYLTTFPRRQIVPAANGTARGIFQQFTPFFGVSYTF*
Ga0163162_1133791923300013306Switchgrass RhizosphereMLRAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTQVFGVGYLF*
Ga0181524_1018930533300014155BogYLTTFPKQQIVPAAYSTARGIFQQFTPMAGVSYVF*
Ga0181529_1003994153300014161BogGVKFRPMPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF*
Ga0181532_1003824513300014164BogHMVLRAEFRDYITTFPRQQIVPALHNTARGIFEQFTPLFGVSYTF*
Ga0181528_1001813953300014167BogPLPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF*
Ga0181528_1029975013300014167BogLRAEFRDYLTTFPRQEIVPAVHNTARGIFEQFTPLLGIDYTF*
Ga0181535_1032878113300014199BogRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF*
Ga0182014_1019360713300014491BogMEMRLEFRDYLTTFPRQQIVPAPNNTARGIFQQFTPLFGVVYVIQSRR*
Ga0182024_1265233813300014501PermafrostEFRDYLTTFPRQEIVPAAHNTARGIFEQFTPLFGVAYTFR*
Ga0181522_1023724713300014657BogRPLPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF*
Ga0181522_1091831723300014657BogDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGIAYTF*
Ga0182030_1113143423300014838BogKFRLIPRMLLRAEFRDCITTFPRQQIVPAPHNTARGIFEQFTPLFGISYER*
Ga0182030_1137164823300014838BogMLLRAEFRDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGVSYTF*
Ga0134085_1031956213300015359Grasslands SoilSVGGGLKIRPMPHMLLRAEFLDYLTTFPRQQIVPASHNTARGIFQQFTPLFGVSYIF*
Ga0187856_126614523300017925PeatlandYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0187849_137008623300017929PeatlandFDFRDYLTTFPKQQIVPAAYSTARGIFQQFTPMFGVSYLF
Ga0187819_1064970413300017943Freshwater SedimentGVEYRLRPHVLLRGEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0187817_1046761023300017955Freshwater SedimentRLDFRDYINTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF
Ga0187781_1036422013300017972Tropical PeatlandSAGGGISFKPIPHLLLRGEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGASYTFR
Ga0187872_1008115623300018017PeatlandTTFPRQEIVPAPHNIARGIFEQFTPLFGISYTFQGR
Ga0187857_1014415413300018026PeatlandDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF
Ga0187863_1004229853300018034PeatlandEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0187863_1019540433300018034PeatlandRDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGISYTF
Ga0187887_1057055313300018043PeatlandFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYKFARR
Ga0187890_1068920313300018044PeatlandQMEMRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYIF
Ga0187851_1055995323300018046PeatlandKYRLTDHVQLRFDFRNYLTTFPKQQIVPAAYSTARGIFQQFTPVVGVSYVF
Ga0187851_1066495613300018046PeatlandFRPIKQMEMRVEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLFGVVYVIQSRR
Ga0187766_1017718633300018058Tropical PeatlandRVDFRDYLTAFPHDQIAPAKGNTARGIFQMFTPMVGVSAWF
Ga0187784_1094119923300018062Tropical PeatlandYRLIDHMQLRVDFRDYLTTFPRTQIVPAPHNTARGVFEQFTPLFGVSYTF
Ga0187771_1105787833300018088Tropical PeatlandFRDYMTTFNRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0181514_128533923300019268PeatlandGGGAKFRLLKQMEMRVEFRDYLTTFPRQQIVPAPHNTARGVFQQFTPLFGVVYVIQSGR
Ga0187800_113515733300019278PeatlandDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGAGYTF
Ga0187800_114195113300019278PeatlandGGLRFRPMKQMEMRVEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLFGVVYVIQSRR
Ga0187800_156337713300019278PeatlandLLLRAEFRDYVTTFPRQQIVPAPHNTARGIFEQFTPVFGVSYTFGM
Ga0213876_1052025613300021384Plant RootsVKYRLQRHVILRADFRDYLTTFPKRQLMPAPHGTARGIFEQFTPFFGVSYVF
Ga0213876_1063320023300021384Plant RootsYLTTFPRQQIAPAPHNTARGIFEQFTPLFGLSYVF
Ga0126371_1151976813300021560Tropical Forest SoilKVLLRGEFLDYLTTFPRTQIVPAPHNTARGIFEQFTPLFGVSYVF
Ga0222756_108123613300022709SoilLRVDFLDYITTFPRRQIMPAPHGTARGIFQQFTPLFGVSYTF
Ga0224545_106357513300022881SoilFRLLPQMLLRVEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVSYTF
Ga0224558_118926913300023090SoilDYLTTFPKQQIVPAAYSTARGIFQQFTPMLGVSYVF
Ga0247551_10564923300023552SoilGVKFRVQEHVLLRVDFLDYITTFPRRQIMPAPHNTARGMFQQFTPLFGISYTF
Ga0208686_113271223300025500PeatlandAEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF
Ga0209039_1036267723300027825Bog Forest SoilIQHMLLRAELRDYLTTFPRQQIVPAPHNTARGVFEQFTPLFGVSYTF
Ga0209693_1055817213300027855SoilYITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0209579_1040464613300027869Surface SoilIQEHVLLRVDFLDYITTFPRRQIMPAPHDTARGMFQQFTPLFGVSYTF
Ga0209380_1026941713300027889SoilLLRGEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0311359_1061937113300029914BogMPHMLLRAEFRDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGISYTF
Ga0311340_1102385723300029943PalsaRDHMLLRGEFLDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGISYTF
Ga0311371_1107060023300029951PalsaILLRGEFLDYLTTFPRQQIVPAPNSTARGIFEQFTPLFGISYTF
Ga0311371_1229045113300029951PalsaVKFRPIKQMEMRLEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLLGLVYVIQSRR
Ga0311342_1094909913300029955BogGGVKFRLRSHMLLRAEFRDYLTTFDRQEIVPAPHNTARGIFEQFTPLFGLSYTF
Ga0311339_1141847723300029999PalsaGCGVKFRPIKQMEMRLEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLLGLVYVIQSRR
Ga0307482_119268913300030730Hardwood Forest SoilVQTHILLRLDFRDYITTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF
Ga0265459_1403460613300030741SoilKYRIQEHVVLRVDFLDYITTFPRRQILPAPGNTARGLFEQFTPLFGVGYLF
Ga0302324_10006945723300031236PalsaVQFRLIDHMLLRADFRDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGVSYTF
Ga0302324_10120062323300031236PalsaEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGISYTR
Ga0265332_1027729013300031238RhizosphereRPHLVLRAEMRDYLTTFPRQQIVPAAHNTARGIFEQFTPLFAIGYSF
Ga0302140_1007086633300031261BogMPHMEWRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVAYTFR
Ga0302140_1028245623300031261BogMELRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0170818_10373126133300031474Forest SoilAEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0302320_1139286013300031524BogMLLRAEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGL
Ga0302326_1220618923300031525PalsaVEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF
Ga0318541_1087385013300031545SoilGGGLTFLLHPHVLLRTEFRDYLTTFPRQQIVPAPNNTARGIFEQFTLLFGVSYTF
Ga0307483_103164813300031590Hardwood Forest SoilGVKFRIQEHVLLRVDFLDYITTFPRRQIMPAPHGTARGMFQQFTPLFGVSYTF
Ga0310686_11462766713300031708SoilLRAEFRDYLTTFPRTEIVPAPHNTARGIFEQFTPVFGVSYTF
Ga0316032_10738813300031956SoilRIQEHILLRLDFLDYITTFPRQQILPAPHNTARGIFEQFTPLFGVSYSF
Ga0311301_1109814123300032160Peatlands SoilHMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF
Ga0348332_1035414323300032515Plant LitterVLLRLDFRDYITTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF
Ga0335085_1198297013300032770SoilSPMPHVLVRAEFLDYITTFPRQQIVPAPHNTARGIFEQFTPLFGISYVF
Ga0335082_1070384123300032782SoilEFRDYLTTFPRQQIVPAPHNTARGIFQQYTPLFGLGYTF
Ga0335079_1072159323300032783SoilRDYMTAFPKQQIVPAEHSTAHGIFHQYTPLLGLSYTF
Ga0335079_1160722813300032783SoilDFRDYLTTFPKKQIVPAIYSTDRGIFQQFTPMLGASYTF
Ga0335080_1080382213300032828SoilVTLRVIPHMLVRAELRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTIAR
Ga0335081_1270191213300032892SoilLLLRAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVRYTF
Ga0335069_1249418213300032893SoilLLRPHMLLRAEFRDYLTTFPRQQIVPAEHNTARGVFEQFTPLVGVSYTF
Ga0335071_1094880623300032897SoilEYRLIPHMLLRVEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTFGR
Ga0335076_1174819813300032955SoilAGGGIEYRMRPHVLLRGEFRDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGISYTF
Ga0335073_1051430913300033134SoilEFRDYLTTFPRQEIVPALHNTARGIFEQFTPLFGVSYTFGR
Ga0335077_1138522513300033158SoilRVDFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGLVYTF
Ga0326728_1062029933300033402Peat SoilPRPHVLLRAEFRDYLTTFPRQQIVPAPHNTARGVFEQFTPLFGVSYTF
Ga0326728_1100796113300033402Peat SoilKFRPRPHVLVRAEFRDYLTTFPRTEIVPAPHNTARGVFEQFTPLAGIGYTF
Ga0371489_0061301_1_1593300033755Peat SoilVKFRLLPHMLLRAEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF
Ga0371488_0194541_2_1333300033983Peat SoilLLRAEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF
Ga0370501_0382588_385_5133300034195Untreated Peat SoilLRVEFRDYLTTFPRSQIVPAPHNTARGVFQQFTPLVGAAYAF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.