NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F094976

Metatranscriptome Family F094976

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094976
Family Type Metatranscriptome
Number of Sequences 105
Average Sequence Length 116 residues
Representative Sequence HKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Number of Associated Samples 91
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.62 %
% of genes near scaffold ends (potentially truncated) 93.33 %
% of genes from short scaffolds (< 2000 bps) 99.05 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(80.000 % of family members)
Environment Ontology (ENVO) Unclassified
(95.238 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.14%    β-sheet: 34.72%    Coil/Unstructured: 45.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00089Trypsin 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300007304|Ga0102689_1008919All Organisms → cellular organisms → Eukaryota603Open in IMG/M
3300008832|Ga0103951_10735710All Organisms → cellular organisms → Eukaryota537Open in IMG/M
3300008835|Ga0103883_1011955All Organisms → cellular organisms → Eukaryota827Open in IMG/M
3300008835|Ga0103883_1059189All Organisms → cellular organisms → Eukaryota535Open in IMG/M
3300008998|Ga0103502_10102686All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda1018Open in IMG/M
3300008998|Ga0103502_10118127All Organisms → cellular organisms → Eukaryota951Open in IMG/M
3300009022|Ga0103706_10107818All Organisms → cellular organisms → Eukaryota650Open in IMG/M
3300009025|Ga0103707_10030556All Organisms → cellular organisms → Eukaryota871Open in IMG/M
3300009028|Ga0103708_100318996All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300009269|Ga0103876_1076764All Organisms → cellular organisms → Eukaryota510Open in IMG/M
3300009592|Ga0115101_1067642All Organisms → cellular organisms → Eukaryota579Open in IMG/M
3300009592|Ga0115101_1838712All Organisms → cellular organisms → Eukaryota533Open in IMG/M
3300009606|Ga0115102_10781816All Organisms → cellular organisms → Eukaryota507Open in IMG/M
3300012731|Ga0157616_1228433All Organisms → cellular organisms → Eukaryota620Open in IMG/M
3300018513|Ga0193227_104876All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300018581|Ga0193079_1006123All Organisms → cellular organisms → Eukaryota696Open in IMG/M
3300018590|Ga0193114_1016217All Organisms → cellular organisms → Eukaryota740Open in IMG/M
3300018591|Ga0193398_1004586All Organisms → cellular organisms → Eukaryota598Open in IMG/M
3300018591|Ga0193398_1004680All Organisms → cellular organisms → Eukaryota593Open in IMG/M
3300018600|Ga0192851_1015111All Organisms → cellular organisms → Eukaryota565Open in IMG/M
3300018604|Ga0193447_1016451All Organisms → cellular organisms → Eukaryota666Open in IMG/M
3300018628|Ga0193355_1030031All Organisms → cellular organisms → Eukaryota520Open in IMG/M
3300018636|Ga0193377_1010377All Organisms → cellular organisms → Eukaryota766Open in IMG/M
3300018643|Ga0193431_1035973All Organisms → cellular organisms → Eukaryota530Open in IMG/M
3300018648|Ga0193445_1027067All Organisms → cellular organisms → Eukaryota744Open in IMG/M
3300018659|Ga0193067_1057047All Organisms → cellular organisms → Eukaryota568Open in IMG/M
3300018662|Ga0192848_1024754All Organisms → cellular organisms → Eukaryota702Open in IMG/M
3300018662|Ga0192848_1033290All Organisms → cellular organisms → Eukaryota607Open in IMG/M
3300018662|Ga0192848_1043708All Organisms → cellular organisms → Eukaryota525Open in IMG/M
3300018678|Ga0193007_1057187All Organisms → cellular organisms → Eukaryota520Open in IMG/M
3300018688|Ga0193481_1060559All Organisms → cellular organisms → Eukaryota620Open in IMG/M
3300018696|Ga0193110_1043005All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300018699|Ga0193195_1002901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1318Open in IMG/M
3300018701|Ga0193405_1045370All Organisms → cellular organisms → Eukaryota511Open in IMG/M
3300018702|Ga0193439_1020254All Organisms → cellular organisms → Eukaryota721Open in IMG/M
3300018708|Ga0192920_1072535All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300018721|Ga0192904_1052943All Organisms → cellular organisms → Eukaryota622Open in IMG/M
3300018726|Ga0194246_1058801All Organisms → cellular organisms → Eukaryota606Open in IMG/M
3300018736|Ga0192879_1077544All Organisms → cellular organisms → Eukaryota731Open in IMG/M
3300018752|Ga0192902_1064429All Organisms → cellular organisms → Eukaryota666Open in IMG/M
3300018756|Ga0192931_1070136All Organisms → cellular organisms → Eukaryota686Open in IMG/M
3300018763|Ga0192827_1075344All Organisms → cellular organisms → Eukaryota582Open in IMG/M
3300018763|Ga0192827_1076722All Organisms → cellular organisms → Eukaryota576Open in IMG/M
3300018769|Ga0193478_1083841All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300018792|Ga0192956_1122663All Organisms → cellular organisms → Eukaryota610Open in IMG/M
3300018794|Ga0193357_1051386All Organisms → cellular organisms → Eukaryota683Open in IMG/M
3300018819|Ga0193497_1102490All Organisms → cellular organisms → Eukaryota510Open in IMG/M
3300018849|Ga0193005_1080215All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300018850|Ga0193273_1061761All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300018852|Ga0193284_1061292All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300018852|Ga0193284_1063054All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300018854|Ga0193214_1086758All Organisms → cellular organisms → Eukaryota575Open in IMG/M
3300018859|Ga0193199_1132959All Organisms → cellular organisms → Eukaryota503Open in IMG/M
3300018867|Ga0192859_1050796All Organisms → cellular organisms → Eukaryota676Open in IMG/M
3300018882|Ga0193471_1106376All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300018883|Ga0193276_1069340All Organisms → cellular organisms → Eukaryota728Open in IMG/M
3300018898|Ga0193268_1120374All Organisms → cellular organisms → Eukaryota785Open in IMG/M
3300018898|Ga0193268_1120377All Organisms → cellular organisms → Eukaryota785Open in IMG/M
3300018930|Ga0192955_10054700All Organisms → cellular organisms → Eukaryota921Open in IMG/M
3300018935|Ga0193466_1114460All Organisms → cellular organisms → Eukaryota691Open in IMG/M
3300018940|Ga0192818_10217846All Organisms → cellular organisms → Eukaryota544Open in IMG/M
3300018947|Ga0193066_10185353All Organisms → cellular organisms → Eukaryota599Open in IMG/M
3300018951|Ga0193128_10105826All Organisms → cellular organisms → Eukaryota678Open in IMG/M
3300018953|Ga0193567_10164165All Organisms → cellular organisms → Eukaryota711Open in IMG/M
3300018961|Ga0193531_10020848All Organisms → cellular organisms → Eukaryota2106Open in IMG/M
3300018966|Ga0193293_10115524All Organisms → cellular organisms → Eukaryota535Open in IMG/M
3300018975|Ga0193006_10207626All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300018985|Ga0193136_10218885All Organisms → cellular organisms → Eukaryota567Open in IMG/M
3300018995|Ga0193430_10103667All Organisms → cellular organisms → Eukaryota678Open in IMG/M
3300018996|Ga0192916_10197036All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300018996|Ga0192916_10205245All Organisms → cellular organisms → Eukaryota572Open in IMG/M
3300018998|Ga0193444_10171081All Organisms → cellular organisms → Eukaryota572Open in IMG/M
3300018999|Ga0193514_10193334All Organisms → cellular organisms → Eukaryota734Open in IMG/M
3300019000|Ga0192953_10155643All Organisms → cellular organisms → Eukaryota576Open in IMG/M
3300019004|Ga0193078_10131991All Organisms → cellular organisms → Eukaryota610Open in IMG/M
3300019004|Ga0193078_10194516All Organisms → cellular organisms → Eukaryota530Open in IMG/M
3300019007|Ga0193196_10031634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1733Open in IMG/M
3300019019|Ga0193555_10264881All Organisms → cellular organisms → Eukaryota547Open in IMG/M
3300019022|Ga0192951_10187189All Organisms → cellular organisms → Eukaryota752Open in IMG/M
3300019028|Ga0193449_10384080All Organisms → cellular organisms → Eukaryota555Open in IMG/M
3300019040|Ga0192857_10292380All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300019051|Ga0192826_10045619All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1416Open in IMG/M
3300019091|Ga0192935_1018531All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300019094|Ga0193040_1020635All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300019100|Ga0193045_1055995All Organisms → cellular organisms → Eukaryota627Open in IMG/M
3300019101|Ga0193217_1036137All Organisms → cellular organisms → Eukaryota593Open in IMG/M
3300019105|Ga0193374_1007677All Organisms → cellular organisms → Eukaryota779Open in IMG/M
3300019143|Ga0192856_1067439All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300019143|Ga0192856_1070316All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300019143|Ga0192856_1073626All Organisms → cellular organisms → Eukaryota504Open in IMG/M
3300019147|Ga0193453_1126970All Organisms → cellular organisms → Eukaryota675Open in IMG/M
3300019148|Ga0193239_10223854All Organisms → cellular organisms → Eukaryota689Open in IMG/M
3300030924|Ga0138348_1173489All Organisms → cellular organisms → Eukaryota548Open in IMG/M
3300030955|Ga0073943_10164618All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300031056|Ga0138346_10957193All Organisms → cellular organisms → Eukaryota632Open in IMG/M
3300031121|Ga0138345_11064423All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300031674|Ga0307393_1140546All Organisms → cellular organisms → Eukaryota541Open in IMG/M
3300031717|Ga0307396_10347163All Organisms → cellular organisms → Eukaryota710Open in IMG/M
3300031717|Ga0307396_10386370All Organisms → cellular organisms → Eukaryota670Open in IMG/M
3300031725|Ga0307381_10211934All Organisms → cellular organisms → Eukaryota679Open in IMG/M
3300031737|Ga0307387_10402196All Organisms → cellular organisms → Eukaryota835Open in IMG/M
3300032481|Ga0314668_10600253All Organisms → cellular organisms → Eukaryota557Open in IMG/M
3300032492|Ga0314679_10322811All Organisms → cellular organisms → Eukaryota705Open in IMG/M
3300032616|Ga0314671_10681725All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300032734|Ga0314706_10581296All Organisms → cellular organisms → Eukaryota536Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine80.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.57%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.81%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.86%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018513Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782447-ERR1712145)EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018591Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782350-ERR1711882)EnvironmentalOpen in IMG/M
3300018600Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000535 (ERX1782170-ERR1711950)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018688Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789672-ERR1719470)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018702Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002354 (ERX1789558-ERR1719169)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018721Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)EnvironmentalOpen in IMG/M
3300018726Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)EnvironmentalOpen in IMG/M
3300018736Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000750 (ERX1789504-ERR1719154)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019028Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019101Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782274-ERR1712235)EnvironmentalOpen in IMG/M
3300019105Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782301-ERR1712219)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300030924Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_5 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030955Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0102689_100891913300007304Freshwater LakeSSFSVGPLQLEVSKSSGGGKNRAVRSAMATTETMKGKMTLKVKPDGSAHVKKVSFQKPDQVDVKGSLTDQKKRSDSYVKNSVNKIRPFAAQRILKMARYVLKTPTVQRS*
Ga0103951_1073571013300008832MarineFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN*
Ga0103883_101195533300008835Surface Ocean WaterLSGIATLRRSGAVEITVEEDHKIISSEFTVGPLQLEVSKSFGEAKERQVKTAKASTDVMKGVMVLKVKADGSAHVKKVVFKKPDHVDVSGSLSAKERKSETQLRNSFNRSRGLAAQKILKTARYVLKNTE*
Ga0103883_105918913300008835Surface Ocean WaterMSEFQVGPLQLEVSKVYGNGKGRTVKSAKAITDVMTGVMTLKVKPDGTAHVKKVVFKPPQNVDVKGSLSEDRSRNLRYMKNSVTKMRPLAAIRILKTARYVLKSPSSSN*
Ga0103502_1010268633300008998MarineMERKGDVKVMDEENHKVVTSEFSVGPLQLQVSKIYGRGKARTVKTARAITEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSDSQPRSLTSMRNSVNKMRPLAAMKILKTARYVLKSPAAYKQ*
Ga0103502_1011812713300008998MarineMGSLAGIATLRRSGDVVVGDEESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISNQKKRSDTYLKNSVNKMR
Ga0103706_1010781813300009022Ocean WaterPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN*
Ga0103707_1003055623300009025Ocean WaterVENVDNHKELKSYFHVGPLKLEVSKVYGKGKSRTIRSAKAVTDIMSGVMTLKVKEDGTAHVKKVVFKEPENVDVQGSLSDNKVRSLRSMKETVSQIRPI
Ga0103708_10031899613300009028Ocean WaterGDVSVADEENHKVVTSAFTVGPLQLQVSKIYGKGKARSVKTAKAITDVMSGTLVLKVKADGTAHVKKVVFKKPENVEVKGKLSDSNPRSLNYLRNSVNKMRPLAAMKILKTARYVLKSPTTKQ*
Ga0103876_107676413300009269Surface Ocean WaterENHKVITSEFNVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFKEPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSAN*
Ga0115101_106764213300009592MarineENHKVVTSSFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMSGTMILKVKPDGSAHVKKVVFAKPENVDVKGSLSADKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ*
Ga0115101_183871213300009592MarineGDVTVQEDESHILVTSVFTVGPLQLEVSKSLGHGKARTVKTAKATTDLMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVKGTITSGKKERSENILKNSFNRSRPLAAQKILKTARYVLKGSSNINQS*
Ga0115102_1078181613300009606MarineDESHILVTSVFTVGPLQLEVSKSLGHGKARTVKTAKATTDLMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVKGTITSGKKERSENILKNSFNRSRPLAAQKILKTARYVLKGSSNINQSK
Ga0157616_122843313300012731FreshwaterPLQLEVSKSSGGGKNRAVRSAMATTETMKGKMTLKVKPDGSAHVKKVSFQKPDQVDVKGSLTDQKKRSDSYVKNSVNKIRPFAAQRILKMARYVLKTPTVQRS*
Ga0193227_10487613300018513MarineMDEENHKVVTSKFTVGPIQLEVSKTIGQGKSRTVKTARATTDVMTGTMVLKVKPDGSAHVKKVVFAKPEKVDVKGSLSDNKPRSATYLKNSVNRMRPVAAQKILKTARYVLKAPATVKQ
Ga0193079_100612323300018581MarineTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193114_101621723300018590MarineHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193398_100458613300018591MarineDVMVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193398_100468013300018591MarineVVVADEESHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192851_101511113300018600MarineKVVTSEFSVGPLQLQVSKIYGRGKARTVKTAKAITDVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENDPRSLNYLRNSVNKMRPLAAMKVLKTARYVLKSPNSN
Ga0193447_101645113300018604MarineSHKIVTSAFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193355_103003113300018628MarineMVKEEDNHKVITSEFNVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFKEPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSMANKA
Ga0193377_101037723300018636MarineVGDEESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193431_103597313300018643MarineEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193445_102706713300018648MarineGDVVVGDEESHKIVTSSFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193067_105704713300018659MarineSEFSVGPLQLQVSKIYGKGKARTVKTAKAVTEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENNPRSLNSMRNSVNKMRPLAAMKILKTARYVLKSPTTKQ
Ga0192848_102475423300018662MarineEESHKIVTSSFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192848_103329023300018662MarineAVVDEETHKVVTSEFRVGPLQLQVSKIYGRGKARTVKTAKAITDVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENDPRSLNYLRNSVNKMRPLAALKVLKTARYVLKSPNSN
Ga0192848_104370813300018662MarineGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193007_105718713300018678MarineKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGD
Ga0193481_106055913300018688MarineDNHKTVTSEFTVGPLQLEVSKTYGRGKERTVRTAKASTDVMSGTMILKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSNTYLRNSVNRMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193110_104300523300018696MarineLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAAN
Ga0193195_100290113300018699MarineMDEENHKVVESTFNVGPLKLEVSKVTGKGKERSIKSAIARTDVMMGKMILKVKPDGSAYVKKVVFKEPKNVDVKGSLNDNKQRNIRYLRTSVNRMRPLAAMRVLKTARFVLKGPSNKEN
Ga0193405_104537013300018701MarineSEFSVGPLQLQVSKIYGRGKARTVKTARAITEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSDSQPRSLTSMRNSVNKMRPLAAMKILKTARYVLKSPAAYKQ
Ga0193439_102025413300018702MarineEESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192920_107253513300018708MarineDVMVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAAN
Ga0192904_105294313300018721MarineSHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0194246_105880113300018726MarineDVTVQDEETHKVVTSVFTVGPLQLEVSKSLGHGKGRTVKTAKATTDVMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVRGSISDKKERSQNILKNSFNRSRPLAAQKILKTARYVLKGNSNANHS
Ga0192879_107754413300018736MarineEFTVGPLQLEVSKTYGRGKERTVRTAKASTDVMSGTMILKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSNTYLRNSVNRMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192902_106442913300018752MarineESHKIVTSAFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192931_107013613300018756MarineSAFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192827_107534413300018763MarineVSVADEENHKVVTSAFTVGPLQLQVSKIYGKGKARSVKTAKAITDVMSGTLVLKVKADGTAHVKKVVFKKPENVEVKGKLSDNNPRSLNYLRNSVNKMRPLAAMKILKTARYVLKSPSSK
Ga0192827_107672213300018763MarineDVSVTDEDNHKIVMSEFQVGPLQLEVSKVYGNGKGRTVKSAKAITDVMTGVMTLKVKPDGTAHVKKVVFKPPQNVDVKGSLSEDRSRNLRYMKNSVTKMRPLAAIRILKTARYVLKSPSSSN
Ga0193478_108384113300018769MarineKEEENHKVITSEFNVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFKEPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSMANKA
Ga0192956_112266313300018792MarineVVTSTFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMTGTMILKVKPDGSAHVKKVVFDKPDHVDVKGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0193357_105138613300018794MarineEESHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193497_110249013300018819MarineSLAGIATLRRSGDVAVMDEENHKVVTSKFTVGPIQLEVSKTIGQGKSRTVKTARATTDVMTGTMVLKVKPDGSAHVKKVVFAKPEKVDVKGSLSDNKPRSATYLKNSVNRMRPVAAQKILKTARYVLKAPATVKQ
Ga0193005_108021513300018849MarineDEENHKKVESKFTVGPLMLEVSKTIGQGRSRTVRTAKATTDVMTGNMVLKVKPDGSAHVLKVVFAKPDHVDVQGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0193273_106176113300018850MarineMGLQLQVSKIYGRGKARTVKTARAITEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSDSQPRSLTSMRNSVNKMRPLAAMKILKTARYVLKSPAAYKQ
Ga0193284_106129213300018852MarineGDVLVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193284_106305413300018852MarineTVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193214_108675813300018854MarineDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193199_113295913300018859MarineNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0192859_105079613300018867MarineESHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193471_110637613300018882MarineFNVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFKEPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSMANKA
Ga0193276_106934023300018883MarineKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193268_112037413300018898MarineNHKKVESSFTVGPLMLEVSKTIGQGRSRTVRTAKATTDVMTGNMVLKVKPDGSAHVLKVVFSKPDHVDVQGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0193268_112037713300018898MarineNHKKVESSFTVGPLMLEVSKTVGQGRSRTVRTAKATTDVMTGNMVLKVKPDGSAHVLKVVFSKPDHVDVQGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0192955_1005470023300018930MarineMETWWSETKSHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193466_111446013300018935MarineDEESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192818_1021784613300018940MarineDEETHKVVTSVFTVGPLQLEVSKSLGHGKGRTVKTAKATTDVMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVRGSISDKKERSQNILKNSFNRSRPLAAQKILKTARYVLKGNSNPNHS
Ga0193066_1018535313300018947MarineGSVADEENHKVVTSAFTVGPLQLQVSKIYGKGKARSVKTAKAITDVMSGTLVLKVKADGTAHVKKVVFKKPENVEVKGKLSDNNPRSLNYLRNSVNKMRPLAAMKILKTARYVLKSPSSK
Ga0193128_1010582623300018951MarineFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193567_1016416513300018953MarineSSFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193531_1002084813300018961MarineVGDEESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARLTFLFDFFNL
Ga0193293_1011552413300018966MarineMGENHKIVSSAFTVGPLQLEVSKTLGHGKSRTVKTAKAITDVMSGTMQLKVKADGSAHVKKVVFKKPERVDVKGSLSDNEPRSINVLKNSVNKMRPIAAQKILKTARYVLKAPTATSN
Ga0193006_1020762613300018975MarineVVTSAFTVGPLQLQVSKIYGKGKARSVKTAKAITDVMSGTLVLKVKADGTAHVKKVVFKKPENVEVKGKLSDNNPRSLNYLRNSVNKMRPLAAMKILKTARYVLKSPSSKQ
Ga0193136_1021888513300018985MarineVVTSEFSVGPLQLQVSKIYGRGKARTVKTARAITEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSDSQPRSLTSMRNSVNKMRPLAAMKILKTARYVLKSPAAYKQ
Ga0193430_1010366713300018995MarineGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDRSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192916_1019703613300018996MarineAGDVKVEDEDNHKVVTSEFSVGPLQLQVSKIYGKGKARTVKTAKAVTEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENNPRSLNSMRNSVNKMRPLAAMKILKTARYVLKSPTTKQ
Ga0192916_1020524513300018996MarineTWAVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAAN
Ga0193444_1017108113300018998MarineHGSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193514_1019333423300018999MarineDEESHKIVTSSFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192953_1015564313300019000MarineMGVVTSTFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMTGTMILKVKPDGSAHVKKVVFDKPDHVDVKGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0193078_1013199113300019004MarineMGIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0193078_1019451613300019004MarineEFSVGPLQLQVSKIYGRGKARTVKTARAITEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSDSQPRSLTSMRNSVNKMRPLAAMKILKTARYVLKSPAAYN
Ga0193196_1003163423300019007MarineLRRSGDVVILDEEEHKIVSSEFSVGPLQLEVSKSFGEAKERKMKSAKASTDVMKGMMVVKVKADGSAHVKKVVFKKPEHVDVSGSISEKERKSETQLRNSFNRSRGLAAQKILKTARYVLKSKTDME
Ga0193555_1026488113300019019MarineSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAGN
Ga0192951_1018718913300019022MarineMGVDEDNHKTVTSEFTVGPLQLEVSKTYGRGKERTVRTAKASTDVMSGTMILKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSNTYLRNSVNRMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193449_1038408013300019028MarineVVTSKFTVGPIQLEVSKTIGQGKSRTVKTARATTDVMTGTMVLKVKPDGSAHVKKVVFAKPEKVDVKGSLSDNKPRSATYLKNSVNRMRPVAAQKILKTARYVLKAPATVKQ
Ga0192857_1029238013300019040MarineHGVMVKVEENHKIVTSEFNVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFKEPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSAN
Ga0192826_1004561933300019051MarineVVILDEEEHKIVSSEFSVGPLQLEVSKSFGEAKERKMKSAKASTDVMKGMMVVKVKADGSAHVKKVVFKKPEHVDVSGSISEKERKSETQLRNSFNRSRGLAAQKILKTARYVLKSKTDM
Ga0192935_101853113300019091MarineDVTVKDEDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAAN
Ga0193040_102063513300019094MarineGENHKVVTSSFTVGPLQLEVSKTLGQGKSRTVRTAKATTDVMTGTMVLKVKPDGSAHVKKVVFAKPDHVDVKGSLSDNKPRSITYLKNSVNRMRPMAAQKILKTARYVLKAPATVKQ
Ga0193045_105599513300019100MarineKVVTSSFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMSGTMVLKVKPDGSAHVKKVVFSKPEKVDVKGSLSDNKPRSISYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0193217_103613713300019101MarineMGDNHKIVVSEFSVGPLQLEVSKVYGKGKARTIKSAKAITDVMSGTMTLKVKPDGTAHVKKVVFKEPENVDVKGSLSNNKPRTLRTLKNSVNKMRPLAAIRILKTARYVLKSPSAAN
Ga0193374_100767723300019105MarineESHKIVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0192856_106743913300019143MarineSEFSVGPLQLQVSKIYGRGKARTVKTAKAITDVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENDPRSLNYLRNSVNKMRPLAAMKVLKTARFVLKSPSSN
Ga0192856_107031613300019143MarineTWGSEFSVGPLQLQVSKIYGKGKARTVKTAKAVTEVMSGTLVLKVKPDGQAHVKKVVFKKPENVEVKGKLSENNPRSLNSMRNSVNKMRPLAAQKILKTARYVLKSPTTKQ
Ga0192856_107362613300019143MarineNHKIITSEFHVGPLQLEVSKMYGKGQARTVKSAKAITEVMSGTMTLKVKPDGSAHVKKVVFREPENVDVKGSLSDNKPRNLRYLKNSVNKMRPLAAIRVLKTARYVLKSPNSSAN
Ga0193453_112697023300019147MarineVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0193239_1022385423300019148MarineADEESHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERK
Ga0138348_117348913300030924MarineAVMDEENHKVVTSKFTVGPIQLEVSKTIGQGKSRTVKTARATTDVMTGTMVLKVKPDGSAHVKKVVFAKPEKVDVKGSLSDNKPRSATYLKNSVNRMRPVAAQKILKTARYVLKAPATVK
Ga0073943_1016461813300030955MarineKVVSSEFSVGPLQLQVSKIYGKGKARTVKTAKAVTEVMSGTLVLKVKPDGTAHVKKVVFKKPENVEVKGKLSENNPRSLNSMRNSVNKMRPLAAMKILKTARYVLKSPTTKQ
Ga0138346_1095719313300031056MarineSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0138345_1106442313300031121MarineDVVVADEESHKVVTSTFTVGPLQLEVSKTYGEGKARTVRTAKASTDVMSGTMVLKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSDTYLKNSVNKMRPIAAQKILKTARYVLKAPSTVERKN
Ga0307393_114054613300031674MarineEDNHKVVTSTFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMTGTMILKVKPDGSAHVKKVVFDKPDHVDVKGSLSDNKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0307396_1034716313300031717MarineRTGDVEVVDEDNHKTVTSEFTVGPLQLEVSKTYGRGKERTVRTAKASTDVMSGTMILKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSNTYLRNSVNRMRPIAAQKILKTARYVLKAPSTVERKN
Ga0307396_1038637013300031717MarineIENDENHILVTSVFTVGPLQLEVSKSSGHGKARTVKTAKATTDLMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVKGSISEKKQRSENILKNSFNRSRPLAAQRILKTARYVLKGSSTAKQ
Ga0307381_1021193413300031725MarineRDGDVQIKNAENHKVVKSTFSVGPLSLEVSKKYGSGKARTVRTARAKTAVMQGVMQLKVKEDGSAHILSVVFKKPEDVAVSGSISDNRKRSDNFVKNSVNKMRPLAAQKILKTARYVLKAPHSKKTE
Ga0307387_1040219613300031737MarineRRTGDVEVVDEDNHKTVTSEFTVGPLQLEVSKTYGRGKERTVRTAKASTDVMSGTMILKVKPDGSAHVKKVVFKKPEQVDVLGSISDQKKRSNTYLRNSVNRMRPIAAQKILKTARYVLKAPSTVERKN
Ga0314668_1060025313300032481SeawaterGPLQLEVSKTLGQGKSRTVKTAKATTDVMSGTMILKVKPDGSAHVKKVVFAKPENVDVKGSLSADKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ
Ga0314679_1032281113300032492SeawaterGDVEVQDESSHKTVTSSFTVGPLQLEVSKTYGHGKERTVRTAKASTDVMTGTMILKVKPDGSAHVKKVVFQKPELVDVLGSISDQKKRSDSYLKNSVSKMRPIAAQKILKTARYVLKAPSTKQ
Ga0314671_1068172513300032616SeawaterVQEDESHILVTSVFTVGPLQLEVSKSLGHGKARTVKTAKATTDLMTGVMVLKVKPDGSAHVKKVVFKKPEHVDVKGTITSGKKERSENILKNSFNRSRPLAAQKILKTARYVLKGSSNINHS
Ga0314706_1058129613300032734SeawaterENHKVVTSSFTVGPLQLEVSKTLGQGKSRTVKTAKATTDVMSGTMILKVKPDGSAHVKKVVFAKPENVDVKGSLSADKPRSITYLKNSVNRMRPIAAQKILKTARYVLKAPATVKQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.