NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094790

Metagenome / Metatranscriptome Family F094790

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094790
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 78 residues
Representative Sequence MVFPNCRDWHSTSGPFLHTPVPGLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQDAGLLVKELIQGG
Number of Associated Samples 72
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 68.57 %
% of genes near scaffold ends (potentially truncated) 41.90 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(72.381 % of family members)
Environment Ontology (ENVO) Unclassified
(83.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(70.476 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 28.44%    β-sheet: 0.00%    Coil/Unstructured: 71.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005355|Ga0070671_101524847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii592Open in IMG/M
3300005445|Ga0070708_100954080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii805Open in IMG/M
3300005719|Ga0068861_101744016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii617Open in IMG/M
3300005844|Ga0068862_100732141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii961Open in IMG/M
3300009177|Ga0105248_13227305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii519Open in IMG/M
3300009972|Ga0105137_100454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1218Open in IMG/M
3300009972|Ga0105137_102946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii739Open in IMG/M
3300009973|Ga0105136_102184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii941Open in IMG/M
3300009994|Ga0105126_1025501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii669Open in IMG/M
3300009994|Ga0105126_1053944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii513Open in IMG/M
3300009995|Ga0105139_1124160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii501Open in IMG/M
3300010371|Ga0134125_11642757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii699Open in IMG/M
3300010396|Ga0134126_12318989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii585Open in IMG/M
3300010399|Ga0134127_13701313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii502Open in IMG/M
3300010401|Ga0134121_11894257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii625Open in IMG/M
3300010401|Ga0134121_12759251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii537Open in IMG/M
3300013306|Ga0163162_12183099All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii636Open in IMG/M
3300014326|Ga0157380_12007700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii640Open in IMG/M
3300014968|Ga0157379_12643100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii503Open in IMG/M
3300014968|Ga0157379_12678378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii500Open in IMG/M
3300015270|Ga0182183_1051434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii613Open in IMG/M
3300015270|Ga0182183_1053291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii607Open in IMG/M
3300015270|Ga0182183_1084566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii523Open in IMG/M
3300015290|Ga0182105_1026095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii807Open in IMG/M
3300015290|Ga0182105_1041348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii700Open in IMG/M
3300015297|Ga0182104_1018930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii925Open in IMG/M
3300015297|Ga0182104_1113973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii513Open in IMG/M
3300015301|Ga0182184_1084496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii536Open in IMG/M
3300015306|Ga0182180_1075832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii545Open in IMG/M
3300015309|Ga0182098_1082712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii589Open in IMG/M
3300015310|Ga0182162_1112907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii530Open in IMG/M
3300015311|Ga0182182_1089374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii565Open in IMG/M
3300015313|Ga0182164_1109340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii550Open in IMG/M
3300015317|Ga0182136_1130924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii518Open in IMG/M
3300015319|Ga0182130_1043316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii757Open in IMG/M
3300015319|Ga0182130_1052905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii708Open in IMG/M
3300015319|Ga0182130_1131481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii511Open in IMG/M
3300015320|Ga0182165_1078452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii645Open in IMG/M
3300015320|Ga0182165_1080267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii639Open in IMG/M
3300015320|Ga0182165_1104386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii578Open in IMG/M
3300015324|Ga0182134_1048622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii763Open in IMG/M
3300015324|Ga0182134_1076019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii651Open in IMG/M
3300015324|Ga0182134_1111715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii563Open in IMG/M
3300015324|Ga0182134_1135747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii521Open in IMG/M
3300015325|Ga0182148_1071894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii657Open in IMG/M
3300015326|Ga0182166_1105363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii570Open in IMG/M
3300015327|Ga0182114_1086885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii649Open in IMG/M
3300015328|Ga0182153_1124812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii545Open in IMG/M
3300015332|Ga0182117_1136857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii553Open in IMG/M
3300015332|Ga0182117_1137868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii551Open in IMG/M
3300015333|Ga0182147_1131946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300015339|Ga0182149_1100277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii633Open in IMG/M
3300015339|Ga0182149_1135714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300015339|Ga0182149_1140848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii550Open in IMG/M
3300015348|Ga0182115_1124334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii820Open in IMG/M
3300015350|Ga0182163_1128790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii781Open in IMG/M
3300015350|Ga0182163_1140343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii749Open in IMG/M
3300015350|Ga0182163_1301985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii500Open in IMG/M
3300015352|Ga0182169_1160119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii735Open in IMG/M
3300015352|Ga0182169_1163457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii728Open in IMG/M
3300015352|Ga0182169_1273031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii548Open in IMG/M
3300015353|Ga0182179_1294616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii527Open in IMG/M
3300015353|Ga0182179_1305055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii518Open in IMG/M
3300015354|Ga0182167_1287585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii586Open in IMG/M
3300015354|Ga0182167_1289846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii583Open in IMG/M
3300015354|Ga0182167_1330093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii536Open in IMG/M
3300017408|Ga0182197_1076167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii654Open in IMG/M
3300017408|Ga0182197_1083692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii631Open in IMG/M
3300017412|Ga0182199_1122432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii616Open in IMG/M
3300017412|Ga0182199_1178209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii532Open in IMG/M
3300017414|Ga0182195_1204191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii520Open in IMG/M
3300017432|Ga0182196_1150058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii510Open in IMG/M
3300017435|Ga0182194_1102181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii588Open in IMG/M
3300017439|Ga0182200_1099719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii600Open in IMG/M
3300017439|Ga0182200_1162321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii504Open in IMG/M
3300017447|Ga0182215_1075222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii736Open in IMG/M
3300017691|Ga0182212_1137249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii556Open in IMG/M
3300017692|Ga0182210_1060286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii788Open in IMG/M
3300017692|Ga0182210_1125710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii562Open in IMG/M
3300017692|Ga0182210_1130314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii553Open in IMG/M
3300017693|Ga0182216_1216337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii510Open in IMG/M
3300017792|Ga0163161_11589725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii576Open in IMG/M
3300020023|Ga0182178_1008757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii698Open in IMG/M
3300025903|Ga0207680_11291774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii519Open in IMG/M
3300028054|Ga0268306_1008713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii778Open in IMG/M
3300028056|Ga0268330_1020555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii742Open in IMG/M
3300028062|Ga0268342_1005367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii996Open in IMG/M
3300028064|Ga0268340_1029061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii741Open in IMG/M
3300028144|Ga0268345_1020272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii566Open in IMG/M
3300028379|Ga0268266_11965023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300028464|Ga0268302_106370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum563Open in IMG/M
3300032502|Ga0214490_1147476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii531Open in IMG/M
3300032593|Ga0321338_1302930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii573Open in IMG/M
3300032593|Ga0321338_1348205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii530Open in IMG/M
3300032697|Ga0214499_1239636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300032791|Ga0314748_1028197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1156Open in IMG/M
3300032811|Ga0314718_1037090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii577Open in IMG/M
3300032821|Ga0314719_1031723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii658Open in IMG/M
3300032827|Ga0314730_120671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii711Open in IMG/M
3300032959|Ga0314738_1032824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii937Open in IMG/M
3300032959|Ga0314738_1069367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii631Open in IMG/M
3300033530|Ga0314760_1063471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii915Open in IMG/M
3300033530|Ga0314760_1130638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii616Open in IMG/M
3300033531|Ga0314756_1027344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1013Open in IMG/M
3300033534|Ga0314757_1103208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii688Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere72.38%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere5.71%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated5.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032827Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070671_10152484723300005355Switchgrass RhizosphereMVFPNCRDWHSTSGPFLHTPVPGLPEALLGNRFTADRGCGSCLGLGCPDLLQSYRELCLLSSMGLLSPIVGLLIKELIQRG*
Ga0070708_10095408013300005445Corn, Switchgrass And Miscanthus RhizosphereMVFPNCRDWGSTSGPFLHTPVSGLPEALLSNCFTADCGCGSCLGLGCSYLLQSHRELCLLGSMGLLPQNVGLLVKELIQGG*
Ga0068861_10174401623300005719Switchgrass RhizosphereMVFPNCRDWGSTSGPFLHTPVSGLPEALLSNCFTADRGCGFCLGLGCSDLLEPHREFSLLSTMGLLPQQVGLFIEELIQSG*
Ga0068862_10073214123300005844Switchgrass RhizosphereMVFPNCRDWGSTSGPFLHTPVSGLPEALLSNCFTADRGCGSCLGLGCSYLLQSHRELCLLGSMGLLPQNVGLLVKELIQGG*
Ga0105248_1322730513300009177Switchgrass RhizosphereDWGSTVSPFLHTLVPGLPEALLSNCFTADRGCGPCLGLDCSDLLQSHRELCLLGSMGLFPQQVGLFVKELIQGG*
Ga0105137_10045423300009972Switchgrass AssociatedPKYNMVFPNCRDWHSTSGPFLHTPVPGLPEAILGDRFAADRGCGTCFGLGCPDLLLSYRELGLLGSMGLLPQDAGLLVKELIQGG*
Ga0105137_10294613300009972Switchgrass AssociatedMVFSDGRNWGPTSGPFLHAPVSGLSEALLCNRFTADRGCGSCLGLGCSDLLEPHREFSLLSAMGLLPQQVGLFIEELIQSG*
Ga0105136_10218423300009973Switchgrass AssociatedMIFPNHRDWCPTSGPFLHTPVPGLPEALLGNRFAADRGCGSCLGLGYPDLLQSYRELCLLGSMDLLPQDAGLLVKELIQGG*
Ga0105126_102550113300009994Switchgrass AssociatedMIFPNCRDWHSTSGPFFHAPVPSLPEALLDNRFAADRGCGSCFGLGCPDLLQSYRELCLLGSMDLLPQDVGLLVKELIQRG*
Ga0105126_105394413300009994Switchgrass AssociatedLHTLASGLPEALLSDCFTADRGCGSCLGLGCSYLLQSHRELYLLGSMGLLPQNVGLLVKELVQGG*
Ga0105139_112416013300009995Switchgrass AssociatedMVFPNCWDWHSASGPFLHTPVLGLSEALLSNRFAADRGCSSCLGLGCSYLLQSHRELCLLGSMGLLSQNVVLLIKELIQRG*
Ga0134125_1164275713300010371Terrestrial SoilMVFSDGRNWGPTSGPFLHVPVSGLSEALLCNCFTADRGCGSCLGLGCSDLLEPHREFSLLSTMGLLPQQVGLFIEELIQSG*
Ga0134126_1231898923300010396Terrestrial SoilMVFPNCLDWPSASGPFLHTPVSCLPEALLGNCFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQNAGLLVKELVQGG*
Ga0134127_1370131313300010399Terrestrial SoilMVFPDGRDWGPTSGPFLHAPVSGLPEAFLGNCFTADRGCGSCLSLGCLDLLEPHREFSLLSMMGLLPQQVGLLVKELVQRG
Ga0134121_1189425723300010401Terrestrial SoilMVFPNCRDWHSTSGPFLHTPVPGLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQDAGLLVKELIQGG*
Ga0134121_1275925123300010401Terrestrial SoilMVFPNCRDWLSASGPFLHTPVSGLPEALLSNRFAADRGCGSCLDLGCPDLLQSYRKLYLPGSMGLLSQNVGLLVKELVQGG*
Ga0163162_1218309923300013306Switchgrass RhizosphereMVFPNCRDWRSTSGLFLHTSVPGLPEALLGNHFTTDRGCGSCLGLSHPDLMHPYRELCLLGPMGLLPQDAGVLVKELIQGG*
Ga0157380_1200770013300014326Switchgrass RhizosphereMVFPDGRDWGPTSGPFLHAPVSGLPEAFLGNCFTADRGCGSCLSLDCSDLLQSYRELCLLGSMGLFPQQVGLLVKELIQGG*
Ga0157379_1264310013300014968Switchgrass RhizosphereGLPQLLGLVFHLHTPVSGLPEALLGNCFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLSQNVGLLIKELIQRG*
Ga0157379_1267837813300014968Switchgrass RhizosphereMGFPNFRDWHSTLGAFLHMPVLGLPEALLGNRFTTHRGCGSCLGLSHLDLMHSHCELYLLGPMGLLSQDAGFLVKELIQGG*
Ga0182183_105143413300015270Switchgrass PhyllosphereMVLSDGRNWGLISGPFLHAPVSGLSETLLCNCFTADRGCGSYLGLGCSDLLEPHREFSLLSTMGLLPQQVGLFIEELI
Ga0182183_105329123300015270Switchgrass PhyllosphereMLFPNYRDWRSTSGPFLHVPVPILPEALLGNRFITDRGCGSRLRLGRPDLLHSYCELCLLGPMGLLPQDAGLLVKELIQGG*
Ga0182183_108456623300015270Switchgrass PhyllosphereMVLPNCWDWHSTSGPFLHTPVSGLSEALLSNRFTADCGCGSCLGLGCSYLLQSHCELCLLGSMGLLSQNVGLLIKELIQGG*
Ga0182105_102609513300015290Switchgrass PhyllosphereFPNCRDWHSTSGPFLHELVPGLPDALLGNRFTTDHSCSSCLGLSHPDLIHPYREFCLLGPMGLLPQDAGLLVKELIQGS*
Ga0182105_104134813300015290Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHTPVPGLPEALLGNRFAADCGCGSCLGLGCPDLLQSYHELCLLGSMDLLPQDVGLLVKELIQGG*
Ga0182104_101893013300015297Switchgrass PhyllosphereMVFPNCRDWGSTSGPLLQTPVSGLPEALLSNYFTADRSCGSCLGLGCSYLLQYHRELCLLGSMGLLPQNVGLLVKELILGG*
Ga0182104_111397313300015297Switchgrass PhyllosphereLHAPVLGLPEALLCNCFTADRGGGSCLGLGCSDLLEPHREFSLLSTMGLLPQQVGLLIEELIQSG*
Ga0182184_108449623300015301Switchgrass PhyllosphereMVFPNCQDWRSTSGPFLHTPVPGLPEALLGNRFAADRGCGSCLGLGYPDLLQSYRGLCLLGSMDLLPQDVGLLVKELI
Ga0182180_107583213300015306Switchgrass PhyllosphereMVFPNCRDWRSTSGLFLHAPVSGLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELYLLGSMGLLPQDAGLLIKELIQGG*
Ga0182098_108271213300015309Switchgrass PhyllosphereMVFSDGRDWGPTSGPFLHAPVSGLSETLLCNCFTADRGCGSCLGLGCSDLLESHCELCLLGAMGLLP
Ga0182162_111290713300015310Switchgrass PhyllosphereMVFSDGWNWGPTSGPFLHAPISGLSETLLCNCFTADRGCGSCISLGCSDLLEPHHEFSLLSTMGLLPQQVACSSKS
Ga0182182_108937423300015311Switchgrass PhyllosphereMVFPNCRDWRSPSGPFLHKPVSSLPEALLSNRFATDRDCGSCLGLGYPDLLQSYGELCLLGSMGLLPQDAGLLVKELIQGG*
Ga0182164_110934013300015313Switchgrass PhyllosphereMIFSNCRDWGSTSGPFLHTPVSGLPEALLSNCFTADRNCGSRLGLCCSYLLQSHRKLCLLGSMGLLPQNVGLLVKELIQGG*
Ga0182136_113092413300015317Switchgrass PhyllosphereMVFPNYRDWRSASGPFLHTPVSGLPEALLSNRFAADRGCGSFLGLGCPDLLQYYRELCLLGSMGLLSQNVGLLVEDLI*
Ga0182130_104331623300015319Switchgrass PhyllosphereSNCRDWRSTSGPFLYTQVPGLPEALLGNRFTTNRGCGSCLGLGHPDLMHSYRELCLLGPVDLLPQDAGLLIKELIQGG*
Ga0182130_105290513300015319Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHTPVSGLPEALLGNRFAADRGCGSCLGLGCMDLLQSYRELCLLGSMGLLPQDAGLLVKELIQGG*
Ga0182130_113148113300015319Switchgrass PhyllosphereMVFPNCRDWHSASGPFLHTPVSGLPEALLSNRFAADRGCGSCLGLGCPDLLQSYRELCLLVSMGLLPQDVGLLVKELVQGG*
Ga0182165_107845213300015320Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHMPVSSLAEAFLGNRFAADRGCVSRFDLGCPDLLQSYRGLYLLSSMGLLPQDAGLLIKELVQGV*
Ga0182165_108026723300015320Switchgrass PhyllosphereMGFPNCRDWHSSSSPFLHTPVPALLEALLGNRFTTDRGCGPCLGLSHQDLMHSYREVCLLGPMGLLPQDAGL
Ga0182165_110438613300015320Switchgrass PhyllosphereMVFSDGRNWGPTSGPFLHVPVSGLSEALLCNRFTADRGCGSCLGLGCSDLLEPHREFSLLSAMGLLPQQVGLFLEELIQG
Ga0182134_104862213300015324Switchgrass PhyllosphereSTSGPFLHTPVSGLPEALLSNRFAADRDCGSCLGLGCPDLLQSYRELCLLGSMGLLSQNVGLLVKELIQEG*
Ga0182134_107601913300015324Switchgrass PhyllosphereMVFSYCRDWGSTASPFLNALVSGLPEVLLSNYFTADRGCGSCSGLSCSDLLEFHCELCLLGAMGLLPQQVGLFIEELIQSG*
Ga0182134_111171513300015324Switchgrass PhyllosphereRDGHSTSGPFLHASVPGLPEALLGNCFATDRGCGSCLGLSHPDLIHPYREFCLLGPMGLLPQDAGLLVKELIQGG*
Ga0182134_113574713300015324Switchgrass PhyllosphereMVFSDGRNWGPTSGPFLHAPISGLSEALLCNRFTADRGCGSCLGLGCSNLLEPYREFSLLSAMGLLPQQVGLFIEELIQSG
Ga0182148_107189413300015325Switchgrass PhyllosphereMVFSDGRNWGSTSGSFLHAPVSGLSEALLRNCLTADRGCGSGLGLGCSNLLEPHREFSLLSTMGLLPQQVGLFIEELIQSG*
Ga0182166_110536323300015326Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHTPVPSLPEALLGNRFAADRGCGSCLGLGYPDLLQSYRELCLFSSMGCSLRMLACSSKS*
Ga0182114_108688523300015327Switchgrass PhyllosphereMVFPNCRDWRSASGPFLHTPVSGLPEALLSNRFAADRGCGSCLSLGCPDLLQSYRELCLLGSMGLLSQKVGLLIKELIQRG*
Ga0182153_112481213300015328Switchgrass PhyllosphereLHTPVSGLPEALLNNRFPADRGCGSCLGLGCPDLLQYYRELCLLGSMGLLSQNVGFLIKELIQRG*
Ga0182117_113685713300015332Switchgrass PhyllosphereSTSGPFLYTQVPGLPEALLVNRFTTDRGSGSCLGLSHPNLMHPYRELCLLGPMGLLPQEAGLLVKELIQGG*
Ga0182117_113786813300015332Switchgrass PhyllosphereMVFPNCRDWHSTSGPFLHVPVSGLPEALLGNRFVADRSCGSCLGLGCLELLQSYRELYLLGSMGLL
Ga0182147_113194613300015333Switchgrass PhyllosphereMVFPNCRDWCSTSGPFLHKPVSSLPEALLSNHFAADRGYGSCLGLGCSYLLQSHRELCLLGSMGLLPQNV
Ga0182149_110027713300015339Switchgrass PhyllosphereMVFPNCQDWRSASGPFLYMPVSGLPEALLSNRFTADRGCGSCLGLGCLDLLQSYRELCLLSSMGLLSPNVGLLIKELIQRG*
Ga0182149_113571423300015339Switchgrass PhyllosphereMVFSDGRNWGSTSGPFLYAPVSGLSEALLSNCFTADCGCSSCLGLGCSNLLESHRELCLLGTMGLLPQQVSLFIEELIQSG*
Ga0182149_114084823300015339Switchgrass PhyllosphereMVFPNCWDWRSTFGPFLHTPVSGLFEALLSNRFAADRGCGSCLGLGCLYLLQSHRELCLLGSMGLLSQNVGLLIEELIQGG*
Ga0182115_112433423300015348Switchgrass PhyllosphereMVFSDGRNWCPTSGPLLHAPVSGFSEALLCNCLTADRGCGSCLGLGCSNLLEPHREFSLLSTMGLLPQQVGLFIE
Ga0182163_112879013300015350Switchgrass PhyllosphereMGFPNFRDWHSTFGAFLHMPVLGLPEALLGNRFTTHRGCGSCLGLSHLDLMHSYSELYLLGPMGLLSQDAGLLIKDLIQGG*
Ga0182163_114034313300015350Switchgrass PhyllosphereMVFSDGRNWGPTSGPFLHVPVSGLSEALLCNCFTADRGCGSCLGLGCLDLLEPHREFSLLSMMGLLPQQVG
Ga0182163_130198513300015350Switchgrass PhyllosphereMVFPNCRDWRSASGPFLHTPVSGLPEALLSNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLSQNVGLLIKELIQGG*
Ga0182169_116011913300015352Switchgrass PhyllosphereMVFPNCRDWRSASGPFLHTPVPGLPEALLGNHFATDRGCGSCLGLGCPDLLQPYRELCLFGAVGLLPQDAGLLINELIQGG*
Ga0182169_116345713300015352Switchgrass PhyllosphereMVFPNCRDWHSTSGPFLHTPVPGLPEALLGNRFAADRGCRSCLILGCQDLLQPYRELSLLGSMGLLPQDAGLLVKELILGG*
Ga0182169_127303113300015352Switchgrass PhyllosphereMVFPNCRDWHSASGPFLHTPVSCLPKALLDNRFAADRGCGSYLGLGRPDLLQSYRELCLLGSMGLLSQNVGLLIKELIQRG*
Ga0182179_129461613300015353Switchgrass PhyllosphereMIFPNCQDWHSTSGPFLHTPVPGLPEALLGNRFAADRGCGSYLGLGYPDLLQSYHEVCLLGSMDLLPQDVGLLVKELIQGG*
Ga0182179_130505513300015353Switchgrass PhyllosphereMVFPNCRDWRSASGPFLHTPVSGLLEALLSNRFAVDRGCGSCLGLGCPDLLQSYRELCLLGSMGLLSQDVGLLIKELIQRG*
Ga0182167_128758523300015354Switchgrass PhyllosphereMVFPNFRDWHSTSGPFLHTPVPGLPEALLGNRFVADRGYGSRLGLGCPDLLQPYRELCLLGSMVLLPQDACLLVKELVQGG*
Ga0182167_128984613300015354Switchgrass PhyllosphereMDFPNCRDWHSTSGPFLHTPVLCLPEALLGNRFTADRGCGSCLGLGCPDLLQSYRELYLLGSMGLLPQDSGLLVKELVQGG*
Ga0182167_133009313300015354Switchgrass PhyllosphereGRSEQNMVFSYCRDWGSTVSPFLHTLVSGLPEALLSNRFTADRGYGSCLGLGCPDLLLSHRELCLLGSMGLLSQNVGFLIKELIQRG*
Ga0182197_107616713300017408Switchgrass PhyllosphereMVFSDGRNWGSTPGSFLHAPVSGLSEALLCNCLTADRDCGSCLGLGCTDLLEPHREFSLLSTMGLLPQ
Ga0182197_108369213300017408Switchgrass PhyllosphereMVFPNCRGWRSASGPFLHMPVSGLPEALLSNRFVADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLS
Ga0182199_112243223300017412Switchgrass PhyllosphereMGFSNCQDWHSTSGPFLYTQVPGLPEALLDNRFTTDRGYGSCLGLSHPDLMHPNRELCLLGPMGLLPHNAGLLVKELI
Ga0182199_117820913300017412Switchgrass PhyllosphereMVFSYCRDWGSTSSPFLQTPVPGLLEALLSNCFTADCSRGSCLGLGCSYLLQSYRELCLLGSMGLLP
Ga0182195_120419113300017414Switchgrass PhyllosphereMVFPYCRDWGSTASPFLHTPVPGLPEALLSNCFTADRGCGSCLGLDCSDLLQSYREFCLLGSVGLFPQQVGLLVKELIQ
Ga0182196_115005813300017432Switchgrass PhyllosphereMVFSNCRDWRSASGPFLHTPVPGLPEALLGNRFATDRGCGSCLGLGYPDLLQSYRELCLLGSMGLFPQQVGLLVKELIQGG
Ga0182194_110218123300017435Switchgrass PhyllosphereMVSPNCRDWGSTSGPFLHTPVSGLPEALLSNRFAANRGCGSCLGLGCPDLLQSYRELCLLGSMGLLSQNVGLLIKDLIHRGYVGSHLVQGVFFMAAPF
Ga0182200_109971923300017439Switchgrass PhyllosphereNCWDWRSTSGPFLHTPVSGLSEALLSNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQDAGLLVKELIQGG
Ga0182200_116232113300017439Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHMPVSCLPEALLGNRFATDRGCGSCLSLGCPDLLQPYRELCLFGSMGLLPQ
Ga0182215_107522213300017447Switchgrass PhyllosphereMVFPNCRDWRSTPGPFLHTPVLSLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELGLLGSMGLLPQNASLLVKELIQGG
Ga0182212_113724923300017691Switchgrass PhyllosphereVFPNCGDWRSASGPFLHTPVSGLSEALLSNCFATDRSCGSCLGLGCSYLLQSHRELCLLGSMGLLPQNVGLLVKELIQGG
Ga0182210_106028613300017692Switchgrass PhyllosphereMVFPNCRDWRSTYSSFLHTPVPGLPEALLGNRFAADRGCGSCVGLGCPDLLQSYRELCLLGSMGLLS
Ga0182210_112571023300017692Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHMPVSGLPEALLSNHFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQDAGLLIKELVQRS
Ga0182210_113031413300017692Switchgrass PhyllosphereMVFPNCLDWPSASGPFLYTQVPGLPAALLGNRFTTDRSCDSYLGLSHLDLMHPYHELCL
Ga0182216_121633713300017693Switchgrass PhyllosphereMVFPNCWDWHSASGPFLHTPVPGLLEALLGNRFAADHGCGSCLGLGCPDLLQSYRELCLLGSMGLL
Ga0163161_1158972533300017792Switchgrass RhizosphereGPFLHTPVSGLPEALLSNRFAADRGCGSCLGLGCLDLLQSYHELCLLGSMGLLSQNVGLLVKELIQGG
Ga0182178_100875723300020023Switchgrass PhyllosphereMGFSNCRDWRSTSGPFLYTQVPSLPKALLGNRFTTDRGCGSCLGLSHPDLMHSYRELCLLGPMGLLPQNAG
Ga0207680_1129177423300025903Switchgrass RhizosphereMVFSYCRDWSSTTSPFLHTLVPGLPEALLSNCFTADCGCGSCLGLGCSYLLQSHRELCLLGSMGLLPQNVGLLVKELIQGG
Ga0268306_100871323300028054PhyllosphereMVFSDGRNWGPTSGPFLHAPVSGLSEALLCNCFTADRGCGSCLGLGCSDLLEPHREFSLLSMMGLLPQQVGLLVKELVQGG
Ga0268330_102055513300028056PhyllosphereSSPFLHTLVSGLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLSHNVGLLIKELIQRG
Ga0268342_100536723300028062PhyllosphereMVFSDGRNWGPTSGPFLHALVSGLSEALLCNCFTADCGCGSCLGLGCSDLLEPHREFSLLSTMGLHPRQVGLFIEELIQS
Ga0268340_102906113300028064PhyllosphereMVFSDGRNWGPTSRPFLHAPVSGLSEAFLCNCFTADRSCSSCLGLGCSDLLEPHREFSLLGTMGLLPQQVGL
Ga0268345_102027223300028144PhyllosphereRSASGPFLHTPVLGLPEALLSNRFAADHGCGSCLGLGCLDLLQSYRELCLLGSMGLLSQNVGLLIKELIQRG
Ga0268266_1196502323300028379Switchgrass RhizosphereMSFSNCRDWRSISGPFLYTQVPGLPEALLGNRFTTDRGCSSCLGLSHPDLMHSYRELCLLGPMGLFPKDAGLLVKELIQGG
Ga0268302_10637013300028464PhyllosphereISRDRGSTSGPLLHTPISGLPEAFLSNCFTADCGCGSCLGLGCSYLLQSHRELCLLGSMGLLPQNVGLLVKELIQGG
Ga0214490_114747613300032502Switchgrass PhyllosphereMVFPNCQDWRSTSGPFLHTPVPGLPKALLGYRFAADRGCGSCLGLGCPDLLQSYREFCLLGSMGLLPQDAGLLVKELIQGG
Ga0321338_130293013300032593Switchgrass PhyllosphereMVFPNCWNWRPTSGPFLHTPVPGLPEALLGNRFAADRGCGSCLGLGCPYLLQSHRELWLFGSMGLLPKDAGLLVKS
Ga0321338_134820513300032593Switchgrass PhyllosphereMVFSDGRNWCPTSGPFLHAPVSGLSEALLCNCFTADRGCGSCLGLGCSDLLEPHREFSLLSTMGLLPQQVGLFIEELIQSG
Ga0214499_123963623300032697Switchgrass PhyllosphereMVFSNCWDWGSTSSPFLHTPIPGLPEALLSNCFTADRGCGSCLGLDCSDLLQSYRELCLLGSMGLFPQQVGLLVKELIQGG
Ga0314748_102819723300032791Switchgrass PhyllosphereMGFSNCRDWRSTSGPFLHTPVPDLPEALLGNRFATDRGYGSCLGLGCPDLLQSYRELCLLGSMGLLPQDVGLFVKELIQGG
Ga0314718_103709013300032811Switchgrass PhyllosphereMVFLNCRDWGSTSGPFLHTPVSGMPEALLSNCFTADRGCGSCLGLSCSYLLQSHRELCLLGSMGLLPQNVGLLIKELIQGG
Ga0314719_103172323300032821Switchgrass PhyllosphereMVFPNCRDWRSTFGPFLHTSVPGLPEALLGNCFATDRGCGSCLGLSHSDLMHPYCELCLLGSMGLLPQDAGLLVKELIQGG
Ga0314730_12067123300032827Switchgrass PhyllosphereGRSEQNMVFSYCRDWGSTSSPFLHTPVPGLSEALLSNCFTADRGCGSCLSLDCSDLLQSYRELCLLGSMGLFPQQVGLLVKELIQAG
Ga0314738_103282423300032959Switchgrass PhyllosphereMVFPNCWDWRSTSGPFLHTPVSGLSELLSNRFAADRGCGSCLGLGCSYLLQSHRELCLLSPMDLLPQNVGLLVKELIQEG
Ga0314738_106936723300032959Switchgrass PhyllosphereGFTSGPFLHTPVSGLPEALLSNCFTADCGCGSCLGLGCSYLLQSHCELSLLGTMGLLPQQVGLFIEELIPKRLGS
Ga0314760_106347113300033530Switchgrass PhyllosphereMVFPNCRDWRSTSGPFLHTPVSCLPEALLGNRFAADRGCGSCLGLGCSYLLQSHRELCLLGSMDLLPQNVGLLVKELIQGG
Ga0314760_113063823300033530Switchgrass PhyllospherePFLHTPVSGLHKALLSNRFAADRGCGSCLGLGCSYLLQSHCELCLFGSVGLLPQKVGLLVKELIQRG
Ga0314756_102734423300033531Switchgrass PhyllosphereMVFSDGRDWGPTSGPFLHAPVAGLSETLLCHCLTADRGCGSCLGLGCSDLLEPHREFSLLSTMGLLPQQVGLFIEELIQSG
Ga0314757_110320813300033534Switchgrass PhyllosphereMVFPNCREWHSTSGPFLHTPVPSLPEALLGNRFAADRGCGSCLGLGCPDLLQSYRELCLLGSMGLLPQNAGLLVKELIQGD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.