Metagenome Family F094353

Basic Information
Family ID	F094353
Family Type	Metagenome
Number of Sequences	106
Average Sequence Length	46 residues
Representative Sequence	IRGEKFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF
Number of Associated Samples	87
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.89 %
% of genes near scaffold ends (potentially truncated)	94.34 %
% of genes from short scaffolds (< 2000 bps)	84.91 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (96.226 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.868 % of family members)
Environment Ontology (ENVO)	Unclassified (36.792 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (70.755 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 22.97% β-sheet: 0.00% Coil/Unstructured: 77.03%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF00072	Response_reg	4.72
PF00069	Pkinase	1.89
PF02518	HATPase_c	1.89
PF09084	NMT1	0.94
PF13531	SBP_bac_11	0.94
PF00486	Trans_reg_C	0.94
PF04392	ABC_sub_bind	0.94
PF00665	rve	0.94
PF13426	PAS_9	0.94
PF00581	Rhodanese	0.94
PF07589	PEP-CTERM	0.94
PF01797	Y1_Tnp	0.94
PF03030	H_PPase	0.94
PF09414	RNA_ligase	0.94
PF14373	Imm_superinfect	0.94
PF00924	MS_channel	0.94
PF00226	DnaJ	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	7.55
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	0.94
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.94
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.94
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.94
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.94
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.94
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	0.94
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.94
COG3808	Na+ or H+-translocating membrane pyrophosphatase	Energy production and conversion [C]	0.94
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.94
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	83.02 %
Unclassified	root	N/A	3.77 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.83 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	81.13 %
Unclassified	root	N/A	3.77 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	81.13 %
Unclassified	root	N/A	3.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	81.13 %
Unclassified	root	N/A	3.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	79.25 %
Unclassified	root	N/A	3.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100223972	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	551	Open in IMG/M
3300004266\|Ga0055457_10134939	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300004463\|Ga0063356_100393932	All Organisms → cellular organisms → Bacteria	1777	Open in IMG/M
3300004463\|Ga0063356_104068480	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	629	Open in IMG/M
3300004643\|Ga0062591_101511316	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	672	Open in IMG/M
3300005293\|Ga0065715_10189753	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1422	Open in IMG/M
3300005295\|Ga0065707_10019283	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1274	Open in IMG/M
3300005327\|Ga0070658_10869325	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	784	Open in IMG/M
3300005332\|Ga0066388_103774234	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	773	Open in IMG/M
3300005336\|Ga0070680_100698836	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	872	Open in IMG/M
3300005339\|Ga0070660_101662832	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	543	Open in IMG/M
3300005353\|Ga0070669_100506941	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1001	Open in IMG/M
3300005365\|Ga0070688_100465117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	948	Open in IMG/M
3300005366\|Ga0070659_101293772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	646	Open in IMG/M
3300005455\|Ga0070663_101132311	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	685	Open in IMG/M
3300005457\|Ga0070662_100444411	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1075	Open in IMG/M
3300005459\|Ga0068867_101517213	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	624	Open in IMG/M
3300005526\|Ga0073909_10064877	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1363	Open in IMG/M
3300005546\|Ga0070696_100753395	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	798	Open in IMG/M
3300005577\|Ga0068857_100721527	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	948	Open in IMG/M
3300005577\|Ga0068857_102489035	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	508	Open in IMG/M
3300005719\|Ga0068861_100105746	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	2247	Open in IMG/M
3300005764\|Ga0066903_107475444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	564	Open in IMG/M
3300005842\|Ga0068858_101211622	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	742	Open in IMG/M
3300006046\|Ga0066652_101009694	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	789	Open in IMG/M
3300006169\|Ga0082029_1803047	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	521	Open in IMG/M
3300006797\|Ga0066659_10847699	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	760	Open in IMG/M
3300006806\|Ga0079220_10491787	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	835	Open in IMG/M
3300006844\|Ga0075428_100096133	All Organisms → cellular organisms → Bacteria → Proteobacteria	3229	Open in IMG/M
3300006844\|Ga0075428_101295381	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	766	Open in IMG/M
3300006847\|Ga0075431_100006571	All Organisms → cellular organisms → Bacteria	11553	Open in IMG/M
3300006853\|Ga0075420_101808711	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300006853\|Ga0075420_101846842	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	517	Open in IMG/M
3300006854\|Ga0075425_100285083	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1901	Open in IMG/M
3300006880\|Ga0075429_100076681	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2911	Open in IMG/M
3300006880\|Ga0075429_100703904	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	885	Open in IMG/M
3300006880\|Ga0075429_101895358	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	516	Open in IMG/M
3300006903\|Ga0075426_10385569	Not Available	1033	Open in IMG/M
3300006904\|Ga0075424_100000553	All Organisms → cellular organisms → Bacteria	29573	Open in IMG/M
3300006904\|Ga0075424_100092839	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3176	Open in IMG/M
3300006914\|Ga0075436_100648318	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	780	Open in IMG/M
3300006954\|Ga0079219_11253679	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	648	Open in IMG/M
3300006969\|Ga0075419_10767255	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	688	Open in IMG/M
3300009100\|Ga0075418_10155472	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2434	Open in IMG/M
3300009100\|Ga0075418_12339104	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	583	Open in IMG/M
3300009147\|Ga0114129_12181105	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300009162\|Ga0075423_11852699	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	651	Open in IMG/M
3300010047\|Ga0126382_11729371	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	585	Open in IMG/M
3300010362\|Ga0126377_12608581	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	581	Open in IMG/M
3300010371\|Ga0134125_10304058	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1771	Open in IMG/M
3300010373\|Ga0134128_10475265	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1394	Open in IMG/M
3300012201\|Ga0137365_10720695	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	729	Open in IMG/M
3300012209\|Ga0137379_10915042	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	782	Open in IMG/M
3300012362\|Ga0137361_10317905	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1426	Open in IMG/M
3300012492\|Ga0157335_1017644	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300012532\|Ga0137373_10900173	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	649	Open in IMG/M
3300012582\|Ga0137358_10542194	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	782	Open in IMG/M
3300012884\|Ga0157300_1067066	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	600	Open in IMG/M
3300012896\|Ga0157303_10138824	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	639	Open in IMG/M
3300012901\|Ga0157288_10156343	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	686	Open in IMG/M
3300012911\|Ga0157301_10352659	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	555	Open in IMG/M
3300012924\|Ga0137413_10339285	All Organisms → cellular organisms → Bacteria	1062	Open in IMG/M
3300012929\|Ga0137404_10989508	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	769	Open in IMG/M
3300012930\|Ga0137407_10297541	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1475	Open in IMG/M
3300013297\|Ga0157378_10215159	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1824	Open in IMG/M
3300014315\|Ga0075350_1216582	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	512	Open in IMG/M
3300015242\|Ga0137412_10659620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	784	Open in IMG/M
3300015264\|Ga0137403_10108721	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2776	Open in IMG/M
3300015371\|Ga0132258_10618706	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2720	Open in IMG/M
3300015371\|Ga0132258_10672660	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2605	Open in IMG/M
3300015372\|Ga0132256_100141166	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2404	Open in IMG/M
3300015372\|Ga0132256_100336723	All Organisms → cellular organisms → Bacteria	1600	Open in IMG/M
3300015372\|Ga0132256_101270336	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	849	Open in IMG/M
3300015372\|Ga0132256_102728463	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300015372\|Ga0132256_103350422	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	539	Open in IMG/M
3300015373\|Ga0132257_100147876	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2750	Open in IMG/M
3300015373\|Ga0132257_100687094	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1271	Open in IMG/M
3300015373\|Ga0132257_103727957	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	554	Open in IMG/M
3300015374\|Ga0132255_100178933	All Organisms → cellular organisms → Bacteria	2985	Open in IMG/M
3300015374\|Ga0132255_100836615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1373	Open in IMG/M
3300015374\|Ga0132255_101570335	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300017792\|Ga0163161_11171077	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	663	Open in IMG/M
3300018028\|Ga0184608_10232891	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	810	Open in IMG/M
3300018076\|Ga0184609_10158857	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1043	Open in IMG/M
3300018422\|Ga0190265_13181285	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	548	Open in IMG/M
3300018469\|Ga0190270_11798542	Not Available	668	Open in IMG/M
3300020006\|Ga0193735_1105156	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	783	Open in IMG/M
3300020061\|Ga0193716_1010897	All Organisms → cellular organisms → Bacteria	4672	Open in IMG/M
3300021073\|Ga0210378_10036679	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1950	Open in IMG/M
3300025909\|Ga0207705_10691783	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	793	Open in IMG/M
3300025923\|Ga0207681_11218394	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	632	Open in IMG/M
3300025930\|Ga0207701_10087545	Not Available	2807	Open in IMG/M
3300025930\|Ga0207701_11004861	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	695	Open in IMG/M
3300025931\|Ga0207644_10712146	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	837	Open in IMG/M
3300025931\|Ga0207644_11584287	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	549	Open in IMG/M
3300025932\|Ga0207690_10276682	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1306	Open in IMG/M
3300025960\|Ga0207651_11932307	Not Available	531	Open in IMG/M
3300025986\|Ga0207658_10422095	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1176	Open in IMG/M
3300027873\|Ga0209814_10284615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	719	Open in IMG/M
3300027907\|Ga0207428_10677903	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	738	Open in IMG/M
3300031446\|Ga0170820_16746176	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	528	Open in IMG/M
3300031716\|Ga0310813_11564589	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	615	Open in IMG/M
3300031740\|Ga0307468_100851695	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	784	Open in IMG/M
3300032075\|Ga0310890_11711483	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	522	Open in IMG/M
3300033475\|Ga0310811_10120389	All Organisms → cellular organisms → Bacteria → Proteobacteria	3363	Open in IMG/M
3300033487\|Ga0316630_11242010	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	663	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	53.77%
Environmental	Environmental	46.23%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	53.77%
Terrestrial	Environmental → Terrestrial	42.45%
Aquatic	Environmental → Aquatic	3.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	42.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	36.79%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.98%
Sediment	Environmental → Aquatic → Sediment	1.89%
Freshwater	Environmental → Aquatic → Freshwater	0.94%
Marine	Environmental → Aquatic → Marine	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.81%
Soil	Host-Associated → Plants → Rhizosphere → Soil	16.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	8.49%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.49%
Loam	Environmental → Terrestrial → Soil → Loam	5.66%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	16.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	8.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.49%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.83%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.89%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.94%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.94%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	18.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.43%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	7.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	6.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.66%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	4.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.89%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.89%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.94%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.94%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.94%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.94%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.94%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.94%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.94%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.94%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300004266	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012884	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014315	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300020061	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094353

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1002239721	3300000559	Soil	IVEGIRGEEFTAGFYDMTKWEEYRRENEKNVCDSCMFADPKYLERYGSCF*
Ga0055457_101349391	3300004266	Natural And Restored Wetlands	GQEFTAGFYDMTKWEEFRRENEQHLCASCMFADPKYIERYGSCF*
Ga0063356_1003939325	3300004463	Arabidopsis Thaliana Rhizosphere	FIGGFYDMAKWEEYRRDNEQYVCDSCMFADPKYVERYGSCF*
Ga0063356_1040684801	3300004463	Arabidopsis Thaliana Rhizosphere	EFTAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF*
Ga0062591_1015113162	3300004643	Soil	IRGEEFTAGFYDMTKWEEYRRDNERHVCESCMFADPKYVERYGSCF*
Ga0065715_101897531	3300005293	Miscanthus Rhizosphere	FSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0065707_100192833	3300005295	Switchgrass Rhizosphere	CDRCQQIVEGIRGEEFSAGFYDMSKWEEYRRHNERYVCESCMFADPKYIERYGSCF*
Ga0070658_108693251	3300005327	Corn Rhizosphere	VIEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0066388_1037742341	3300005332	Tropical Forest Soil	KVVEGIRGEKFTAGFYDMTKWEEYRRDNEQYVCEPCMFADPKYLERYGSRF*
Ga0070680_1006988361	3300005336	Corn Rhizosphere	RGEEFSAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF*
Ga0070660_1016628321	3300005339	Corn Rhizosphere	FSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070669_1005069412	3300005353	Switchgrass Rhizosphere	TCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070688_1004651172	3300005365	Switchgrass Rhizosphere	MCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGSCF*
Ga0070659_1012937722	3300005366	Corn Rhizosphere	HLVEGIRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070663_1011323111	3300005455	Corn Rhizosphere	IRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0070662_1004444112	3300005457	Corn Rhizosphere	IRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0068867_1015172131	3300005459	Miscanthus Rhizosphere	IEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0073909_100648773	3300005526	Surface Soil	YDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0070696_1007533951	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	KQVVEGIRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0068857_1007215271	3300005577	Corn Rhizosphere	QIVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCELCMFADPKYIERYGSCF*
Ga0068857_1024890351	3300005577	Corn Rhizosphere	RCKQVIEGIRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0068861_1001057461	3300005719	Switchgrass Rhizosphere	EGIRGEKFTSGFYDVTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0066903_1074754442	3300005764	Tropical Forest Soil	FYDMTKWEEYRRDNERYVCEPCMFADPKYLERYGSCF*
Ga0068858_1012116222	3300005842	Switchgrass Rhizosphere	AGFYDMSKWEEYRRDNERYVCESCMFADPKYIERYGSCF*
Ga0066652_1010096943	3300006046	Soil	MTKWEEYRRENEQYVCDSCMFADPRYVERYGSCF*
Ga0082029_18030472	3300006169	Termite Nest	VSEQFIAGFYDMTKWEEYRRDNEQHVCSSCMFNDIKYLERYGSCF*
Ga0066659_108476992	3300006797	Soil	ICDRCKKIGEGIRGEGFTAGFYDMEKWEEYRLDENDRQVCGSFMFADPKYVERYGSCF*
Ga0079220_104917871	3300006806	Agricultural Soil	MVEGLRGEQFTAGFYDMEKWEEYRRENERYVCEHCMFADPKYVDRYGSCF*
Ga0075428_1000961335	3300006844	Populus Rhizosphere	EQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075428_1012953812	3300006844	Populus Rhizosphere	EQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0075431_10000657112	3300006847	Populus Rhizosphere	MTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0075420_1018087113	3300006853	Populus Rhizosphere	FTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075420_1018468422	3300006853	Populus Rhizosphere	FYDMTKWEEYRRENEQHLCASCMFADPKYVERYGSCF*
Ga0075425_1002850831	3300006854	Populus Rhizosphere	AGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0075429_1000766811	3300006880	Populus Rhizosphere	DMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075429_1007039042	3300006880	Populus Rhizosphere	FTGGFFEMTKWQECRRGDEQYVCDPCMFADPKYLERYGSSF*
Ga0075429_1018953582	3300006880	Populus Rhizosphere	MTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0075426_103855692	3300006903	Populus Rhizosphere	VTCDRCQQIVEGIRGEEFSAGFYDMIKWEEYRRDNERYVCESCMFADP
Ga0075424_1000005538	3300006904	Populus Rhizosphere	MTKWEEYRRENERYVCESCMFADPKYIERFGSSF*
Ga0075424_1000928394	3300006904	Populus Rhizosphere	MSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0075436_1006483182	3300006914	Populus Rhizosphere	FTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0079219_112536792	3300006954	Agricultural Soil	RGEDFSAGFYDMSKWEEYRRENERYVCESCMFADPKYIERFGSCF*
Ga0075419_107672552	3300006969	Populus Rhizosphere	FEMTKWQECRRGDEQYVCDPCMFADPKYLERYGSSF*
Ga0075418_101554721	3300009100	Populus Rhizosphere	GFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075418_123391041	3300009100	Populus Rhizosphere	AEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0114129_121811052	3300009147	Populus Rhizosphere	GFYDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0075423_118526991	3300009162	Populus Rhizosphere	EGIRGEEFTAGFYNMTKWEEYRRENEQNVCDSCMFADLKYVERYGSCF*
Ga0126382_117293711	3300010047	Tropical Forest Soil	DMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0126377_126085811	3300010362	Tropical Forest Soil	VVEGIRGKDYIGGFFEMTKWPQYRRENEERVCDSCMFADPQYVERYGSFF*
Ga0134125_103040583	3300010371	Terrestrial Soil	DRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGCCF*
Ga0134128_104752651	3300010373	Terrestrial Soil	MTKWKEYRRDNERYVCDACMFADPKYAERYGSCF*
Ga0137365_107206951	3300012201	Vadose Zone Soil	FYDMTKWEEYRHENEQYVCESCMFADPKYVERYGSCF*
Ga0137379_109150421	3300012209	Vadose Zone Soil	DEFIAGFYDMTKWEEYRHENEQYVCDSCIFADPKYVERYGSCF*
Ga0137361_103179051	3300012362	Vadose Zone Soil	DMAKWEEYRRENEQYECDSCMFADPRYVERYGSCF*
Ga0157335_10176442	3300012492	Arabidopsis Rhizosphere	MTKWEEYRRDNEQYVCDSCMFADPKYVERYGSCF*
Ga0137373_109001732	3300012532	Vadose Zone Soil	IVEGIRGEEFIAGFYDMTKWEEYRRENEQYVCHSCMFADPKYIERYGSCF*
Ga0137358_105421942	3300012582	Vadose Zone Soil	FTSGFYDMTKWEEYRRENEQYVCDACMFADPKYVECYGSCF*
Ga0157300_10670661	3300012884	Soil	IRGEEFSAGFYDMNKWEEYRRDNERYVCESCMFADPKYIERFGSCF*
Ga0157303_101388243	3300012896	Soil	RGEEFTAGFYDMTKWEEYRRENEQHLCVSCMFADAKYLERYGSCF*
Ga0157288_101563432	3300012901	Soil	DRCKQIVEGIRGEEFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0157301_103526591	3300012911	Soil	QVVEGIRGEEFCAGFYDMTKWEEYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0137413_103392852	3300012924	Vadose Zone Soil	FYNMTKWKEYRREDEQYVCESCMFADLKYVERYGSCF*
Ga0137404_109895083	3300012929	Vadose Zone Soil	FYDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0137407_102975411	3300012930	Vadose Zone Soil	ICDRCKQIVEAIRGEKFTAGIYGMTKWEEYRRENERYVCESCMFADPKYLERYGSCF*
Ga0157378_102151591	3300013297	Miscanthus Rhizosphere	RGEQFTSGFYDITKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0075350_12165822	3300014315	Natural And Restored Wetlands	ICDRCKQTIEGMRGREFIAGFYDMTKWEEYRHENEDHLCASCMFADPNYLERYGSCF*
Ga0137412_106596202	3300015242	Vadose Zone Soil	VPRKEKGEQFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF*
Ga0137403_101087214	3300015264	Vadose Zone Soil	DMTKWEEYRHENEQYVCDSCMFADPKYVERYGSCF*
Ga0132258_106187065	3300015371	Arabidopsis Rhizosphere	MCDRCKQLVDGIRREQFTAGFYDMAKWEEYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0132258_106726601	3300015371	Arabidopsis Rhizosphere	AEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132256_1001411664	3300015372	Arabidopsis Rhizosphere	QFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132256_1003367231	3300015372	Arabidopsis Rhizosphere	GFYDMTKWEEYRREKEQYVCESAMFADPKYVERYGSCF*
Ga0132256_1012703363	3300015372	Arabidopsis Rhizosphere	CDRCKQIVEGIRGEEFSAGFYDMTKWEEYRRDNERYVCEACMFADPKYLERYGSCF*
Ga0132256_1027284631	3300015372	Arabidopsis Rhizosphere	IRGEKFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF*
Ga0132256_1033504222	3300015372	Arabidopsis Rhizosphere	EQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYVERYGSCF*
Ga0132257_1001478761	3300015373	Arabidopsis Rhizosphere	RCQQIAEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132257_1006870942	3300015373	Arabidopsis Rhizosphere	DRCQQIVEGIRGEKFTTGFYDMATWEVYRRENEQYVCVSCMFADLKYVERYGSCF*
Ga0132257_1037279571	3300015373	Arabidopsis Rhizosphere	GIRGEQFTSGFYDMTKWEEYRCEKEQYVCESCMFADPKYVERYGSCF*
Ga0132255_1001789335	3300015374	Arabidopsis Rhizosphere	GEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132255_1008366151	3300015374	Arabidopsis Rhizosphere	CDRCKQIVEGLRGEEFTAGFYDMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0132255_1015703352	3300015374	Arabidopsis Rhizosphere	DRCKQIAEGIRGEQFTSGFYDMTKWEEYRCEKEQYVCESCMFADPKYVERYGSCF*
Ga0163161_111710771	3300017792	Switchgrass Rhizosphere	MCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGSCF
Ga0184608_102328911	3300018028	Groundwater Sediment	FYNMTKWEEYRRENEQYVCASCMFADPKYVERYGSCF
Ga0184609_101588573	3300018076	Groundwater Sediment	GFYDMTKWEEYRRESEQYVCDSCMFADPKYLERYGSCF
Ga0190265_131812852	3300018422	Soil	YDMTKWEEYQRENEQYVCNSCMFADPKYVERYGSCF
Ga0190270_117985422	3300018469	Soil	DRCKQIVEGIRGEEFTTGFYDMTTWEEYRRENEHYVCVSCMFADPKYVERYGSCF
Ga0193735_11051562	3300020006	Soil	EFTGGFYDMTRWEEYRRENEQHLCNSCMFADPKYVERYGSCF
Ga0193716_10108978	3300020061	Soil	VLFVQIVEGIRGEEFIAGFYEMTKWNEYQRENEQYVCNSCMFADPKYVERYGSCF
Ga0210378_100366794	3300021073	Groundwater Sediment	IAGFYDMTKWEEYRRESEQYVCDPCMFADPKYLERYGSCF
Ga0207705_106917832	3300025909	Corn Rhizosphere	VIEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF
Ga0207681_112183942	3300025923	Switchgrass Rhizosphere	EMFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF
Ga0207701_100875451	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VICDRCKQIVEGIRGEQFTSGFYDMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF
Ga0207701_110048611	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	FTTGFYNMATWEVYRRENEQYVCVSCMFADPKYVERYGSCF
Ga0207644_107121461	3300025931	Switchgrass Rhizosphere	DRCKQVVEGIRGDEFTAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF
Ga0207644_115842872	3300025931	Switchgrass Rhizosphere	RGEEFSAGFYDMIKWEEYRRDNERYVCESCMFADPRYIERYGSCF
Ga0207690_102766821	3300025932	Corn Rhizosphere	GEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF
Ga0207651_119323071	3300025960	Switchgrass Rhizosphere	EFTTGFYDMTTWEEYRRENEQIVCVSCMFADPKYVERYGSCF
Ga0207658_104220953	3300025986	Switchgrass Rhizosphere	AGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF
Ga0209814_102846153	3300027873	Populus Rhizosphere	YDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF
Ga0207428_106779032	3300027907	Populus Rhizosphere	VEGIRGEDFSAGFYDMSKWEEYRRENERYVCESCMFADPKYIERFGSCF
Ga0170820_167461762	3300031446	Forest Soil	FYDMTKWEEYRRENEQYVCDSCMFADPKYLERYGSCF
Ga0310813_115645892	3300031716	Soil	RCKQIVEGIRGEEFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF
Ga0307468_1008516951	3300031740	Hardwood Forest Soil	IVEGIRGEQFTSGFYDMTKWEEYRREKEQYVCESCMFGDPKYVERYGSCF
Ga0310890_117114833	3300032075	Soil	VICDRCKQTVEGIRGQEITAGFYDMTKWEEFRRENEQNLCAWCMFADPKYIDRYGSCF
Ga0310811_101203891	3300033475	Soil	CAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF
Ga0316630_112420101	3300033487	Soil	KQTINGIRGQGFIAGFYDMTKWEEYRRENEEHLCVSCMFADPKYLERYGSCF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign