NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094265

Metagenome / Metatranscriptome Family F094265

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094265
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 48 residues
Representative Sequence MKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQ
Number of Associated Samples 79
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.95 %
% of genes near scaffold ends (potentially truncated) 92.45 %
% of genes from short scaffolds (< 2000 bps) 81.13 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.264 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(53.774 % of family members)
Environment Ontology (ENVO) Unclassified
(66.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(54.717 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 36.96%    β-sheet: 17.39%    Coil/Unstructured: 45.65%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00579tRNA-synt_1b 51.89
PF04978DUF664 4.72
PF02397Bac_transf 1.89
PF04185Phosphoesterase 1.89
PF01738DLH 1.89
PF01061ABC2_membrane 0.94
PF07992Pyr_redox_2 0.94
PF07730HisKA_3 0.94
PF01152Bac_globin 0.94
PF00196GerE 0.94
PF10099RskA 0.94
PF00230MIP 0.94
PF06736TMEM175 0.94
PF01047MarR 0.94
PF13556HTH_30 0.94
PF13490zf-HC2 0.94
PF04679DNA_ligase_A_C 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 51.89
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 51.89
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 1.89
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 1.89
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.94
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.94
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.94
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.94
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.94
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.94
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.94
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.26 %
UnclassifiedrootN/A37.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101479751Not Available555Open in IMG/M
3300005176|Ga0066679_10345458All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300005363|Ga0008090_15651704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300005468|Ga0070707_101515318Not Available637Open in IMG/M
3300005471|Ga0070698_100027681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5893Open in IMG/M
3300005471|Ga0070698_100233253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1773Open in IMG/M
3300005537|Ga0070730_10733585All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005554|Ga0066661_10504385All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005764|Ga0066903_106965030All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006173|Ga0070716_101443023Not Available561Open in IMG/M
3300006804|Ga0079221_10575408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia752Open in IMG/M
3300006806|Ga0079220_10135618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1336Open in IMG/M
3300006904|Ga0075424_100742109Not Available1048Open in IMG/M
3300006954|Ga0079219_11435906All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300009143|Ga0099792_10276908All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300010048|Ga0126373_10604895All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300010376|Ga0126381_101009277All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300010398|Ga0126383_10736660All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300010398|Ga0126383_12868265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. H61563Open in IMG/M
3300011271|Ga0137393_10661816All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300015242|Ga0137412_11053038All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300016387|Ga0182040_10255313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300016387|Ga0182040_10378452All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300016387|Ga0182040_11474260Not Available577Open in IMG/M
3300016404|Ga0182037_10919154All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300016404|Ga0182037_11770201Not Available551Open in IMG/M
3300016445|Ga0182038_10412558All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300017947|Ga0187785_10581229Not Available572Open in IMG/M
3300021560|Ga0126371_10424567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1473Open in IMG/M
3300021560|Ga0126371_11273308All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300021560|Ga0126371_12958420All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300025922|Ga0207646_11229480Not Available656Open in IMG/M
3300025929|Ga0207664_10481844Not Available1110Open in IMG/M
3300026319|Ga0209647_1095734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1427Open in IMG/M
3300027725|Ga0209178_1284056All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300027857|Ga0209166_10471058Not Available647Open in IMG/M
3300027874|Ga0209465_10152820All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300027874|Ga0209465_10207336Not Available978Open in IMG/M
3300031543|Ga0318516_10171383All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300031544|Ga0318534_10357646Not Available840Open in IMG/M
3300031544|Ga0318534_10653867Not Available595Open in IMG/M
3300031564|Ga0318573_10707775Not Available541Open in IMG/M
3300031640|Ga0318555_10772909Not Available518Open in IMG/M
3300031668|Ga0318542_10020385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2714Open in IMG/M
3300031713|Ga0318496_10054418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2077Open in IMG/M
3300031747|Ga0318502_10155872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1305Open in IMG/M
3300031748|Ga0318492_10023879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2690Open in IMG/M
3300031751|Ga0318494_10416267All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300031764|Ga0318535_10415543Not Available600Open in IMG/M
3300031765|Ga0318554_10013754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4091Open in IMG/M
3300031768|Ga0318509_10199002All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300031768|Ga0318509_10804952Not Available520Open in IMG/M
3300031769|Ga0318526_10309669Not Available646Open in IMG/M
3300031770|Ga0318521_10649401Not Available639Open in IMG/M
3300031771|Ga0318546_10722082All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300031778|Ga0318498_10440590Not Available577Open in IMG/M
3300031781|Ga0318547_10239210All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300031782|Ga0318552_10004308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae5459Open in IMG/M
3300031792|Ga0318529_10299141All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031793|Ga0318548_10177139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1044Open in IMG/M
3300031793|Ga0318548_10296169All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300031793|Ga0318548_10473882All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031798|Ga0318523_10060548Not Available1800Open in IMG/M
3300031798|Ga0318523_10288702All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031799|Ga0318565_10062722Not Available1744Open in IMG/M
3300031819|Ga0318568_10016024Not Available3978Open in IMG/M
3300031831|Ga0318564_10001245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8362Open in IMG/M
3300031831|Ga0318564_10157502All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300031831|Ga0318564_10308433All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300031832|Ga0318499_10342156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii575Open in IMG/M
3300031860|Ga0318495_10325297All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031879|Ga0306919_11061043All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031893|Ga0318536_10710125Not Available501Open in IMG/M
3300031894|Ga0318522_10194578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300031896|Ga0318551_10306014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300031897|Ga0318520_10022261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3044Open in IMG/M
3300031897|Ga0318520_10313729Not Available947Open in IMG/M
3300031910|Ga0306923_10213624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora2206Open in IMG/M
3300031945|Ga0310913_10119516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1798Open in IMG/M
3300031946|Ga0310910_11554108Not Available507Open in IMG/M
3300031947|Ga0310909_10109779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2228Open in IMG/M
3300032008|Ga0318562_10424987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii772Open in IMG/M
3300032009|Ga0318563_10015589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3642Open in IMG/M
3300032052|Ga0318506_10536481Not Available518Open in IMG/M
3300032054|Ga0318570_10554922Not Available524Open in IMG/M
3300032055|Ga0318575_10309083All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300032063|Ga0318504_10419493Not Available638Open in IMG/M
3300032063|Ga0318504_10621655Not Available519Open in IMG/M
3300032066|Ga0318514_10064469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1800Open in IMG/M
3300032076|Ga0306924_10290713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1876Open in IMG/M
3300032076|Ga0306924_11367445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii757Open in IMG/M
3300032089|Ga0318525_10011662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3989Open in IMG/M
3300032089|Ga0318525_10233706All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300032205|Ga0307472_102068197Not Available572Open in IMG/M
3300032261|Ga0306920_101425504All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300032261|Ga0306920_103404835Not Available590Open in IMG/M
3300032261|Ga0306920_103819796Not Available550Open in IMG/M
3300033289|Ga0310914_10421616All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300033290|Ga0318519_10065924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1863Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil53.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10147975113300000364SoilMKYALLIYAAPGASEGVQPADDGVINGWLDYTVAMKESG
Ga0066679_1034545813300005176SoilMKYALLIYAVPGASDNPGPAPEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTIR
Ga0008090_1565170423300005363Tropical Rainforest SoilMKYALLIYAVPGASENPGPAPVGVIEDWLDYTAAIKEAGVLLGAEQLTW
Ga0070707_10151531813300005468Corn, Switchgrass And Miscanthus RhizosphereMEDRVKYALLIYATPGAAEGVRPADDGVIDSWLDYTAALKESG
Ga0070698_10002768163300005471Corn, Switchgrass And Miscanthus RhizosphereMKYALLIYTTPGAADGAPPAPADDGVITSWLDYTAAAKEAGVLL
Ga0070698_10023325333300005471Corn, Switchgrass And Miscanthus RhizosphereMKYALLIYAVPGAGENPGPAPEGVVEDWLDYTAAIKEAGVLLGAEQLTWPDT
Ga0070730_1073358523300005537Surface SoilMKYALLIYAVPGASENPAPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRL
Ga0066661_1050438513300005554SoilMKYALLIYAVPGASDNPGPAAEGVIDDWLDYTAAIKEAGVLLA
Ga0066903_10696503013300005764Tropical Forest SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAG
Ga0070716_10144302313300006173Corn, Switchgrass And Miscanthus RhizosphereMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVR
Ga0079221_1057540823300006804Agricultural SoilMKYALLIYAVPGASENPGPAPAGVIEDWLDYTAAIKEAGVLLGAEQLTWP
Ga0079220_1013561823300006806Agricultural SoilMKYALLIYAVPGASEHPGPAAEWVIDDWHDYTAAIKEAGVLLGAEQLTWPDTATTVRLSEGE
Ga0075424_10074210913300006904Populus RhizosphereMKYALLIYAAPGASEGVQPADDGVINGWLDYTVAMKESGS
Ga0079219_1143590633300006954Agricultural SoilMKYALLIYAVPGASENPGPVPEGVIEDWLDYTAAI
Ga0099792_1027690813300009143Vadose Zone SoilMKYALLIYAVPGASENPGPAPAGVIEGWLDYTAAIKEAGVLLGAEQLTWPDTATTVRL
Ga0126373_1060489523300010048Tropical Forest SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLSE
Ga0126373_1223976423300010048Tropical Forest SoilMKYALLIYATPGAAGTAESQQGDGVFDSWLDYTIAIRES
Ga0126381_10100927713300010376Tropical Forest SoilMKYALLIYAVPGASENPGPAPAGVIEDWLDYTAAIKEAGMLLGAEQLTWPD
Ga0126381_10394035913300010376Tropical Forest SoilMKYALLIYSMPEAIRTAEPQQGDGVFDSWLDYTIAIRESG
Ga0126383_1073666013300010398Tropical Forest SoilMKYALLIYAVPGAGENPGPAPAGVIGDWLDYTAAIKEAGMLLGAEQLTWPDTATTVRLADGE
Ga0126383_1286826523300010398Tropical Forest SoilMKYALLIYATPGAAEGASPASADDGVSNSWLDYTAA
Ga0137393_1066181613300011271Vadose Zone SoilMKYALLIYAVPGASENPGPAVEGVIEDWLDYTAAIKEAGVLLGAEQLT
Ga0137412_1105303813300015242Vadose Zone SoilMKYALLIYAVPGASENPGPAIEGVIEDWLDYTAAIKEAG
Ga0182040_1025531333300016387SoilVKYALLIYATPGAAERVRPADDGVIDSWLDYTAALKESGSLL
Ga0182040_1037845223300016387SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDT
Ga0182040_1147426023300016387SoilMKYALLIYTVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPD
Ga0182037_1091915423300016404SoilMKYALLIYAVPGASENPGPVPAGVIGDWLDYTAAIKEAGMLLGAEQLTW
Ga0182037_1177020123300016404SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEA
Ga0182038_1041255813300016445SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQLTWPDTATTIRL
Ga0187785_1058122923300017947Tropical PeatlandMKYALLIYAVPGASENPGPAAEGVIEDWLDYTAAIKEAGVLRGAEQLTWADTATT
Ga0126371_1003306863300021560Tropical Forest SoilMKYALLIYAMPDPAEAGEPQPGEGVIDSWLDYTIALKESG
Ga0126371_1042456723300021560Tropical Forest SoilMKYALLIYAAPGAADGVRPADDGVIDSWLDYTAALKECGSLLAAEQLLTWRRPPA
Ga0126371_1127330823300021560Tropical Forest SoilMKYALLIYAVPGASENPGPAPAGVIEDWLDYTAAIKEAGMLLGAEQLTWPDTATT
Ga0126371_1295842013300021560Tropical Forest SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKE
Ga0207646_1122948023300025922Corn, Switchgrass And Miscanthus RhizosphereVKYALLIYATPGAAEGVRPADDGVIDSWLDYTAALKESGSLLA
Ga0207664_1048184413300025929Agricultural SoilMKYALLIYAAPGASEGVQPADDGVINGWLDYTVAMKESGSLLGAEQLAP
Ga0209647_109573433300026319Grasslands SoilMKYALLIYGAPGAANGVQPAAAPADDGVIDSWIDYTAAMKESGALLA
Ga0209178_128405613300027725Agricultural SoilMKYALLIYAVPGASENPGPAPAGVIEDWLDYTAAIKEAGVLL
Ga0209166_1047105823300027857Surface SoilMKYALLIYAVPGASENPAPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLND
Ga0209465_1015282023300027874Tropical Forest SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAI
Ga0209465_1020733633300027874Tropical Forest SoilMKYALLIYATPGAAEGAPAAPADDGVINSWLDYTAA
Ga0318516_1017138323300031543SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAG
Ga0318534_1035764623300031544SoilMKYALLIYATPGAAEGAQPADDGVIDSWLDYTAAMT
Ga0318534_1065386713300031544SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLS
Ga0318573_1070777513300031564SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTAT
Ga0318555_1077290923300031640SoilMEDRVKYALLIYAIPGAGEGVRPADDGVIDSWLDY
Ga0318542_1002038513300031668SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQLTWPDTA
Ga0318496_1005441833300031713SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQLTWPDTATTIRLA
Ga0318502_1015587233300031747SoilMKYALLIYATPGAAEGVQPADDGVIDSWLDYTAAMKESGVLLG
Ga0318492_1002387913300031748SoilMKYALLIYAVPGASENPGPAPAGVIEDWLDYTVAIKEAGVLLGAEQLTWPDTATTIRLAD
Ga0318494_1041626713300031751SoilMKYALLIYAVPGASENPGPAPEGVIEGWLDYTAAIKDAGVLL
Ga0318535_1041554323300031764SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKE
Ga0318554_1001375453300031765SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLTWPDTATTVR
Ga0318509_1019900213300031768SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVL
Ga0318509_1080495213300031768SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGERRGAEPRTRAAT
Ga0318526_1019076413300031769SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVGGGGGRRPRRGPPPPP
Ga0318526_1030966923300031769SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGELRGAEQRTGADTATT
Ga0318521_1064940113300031770SoilMKYALLIYTVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRMAE
Ga0318546_1072208213300031771SoilMKYALLIYTVPGASENPGPAGEGVIDDWLDYTAAIKEAGVLLGAEQLTW
Ga0318498_1044059013300031778SoilMKYALLIYTVPGASENPGPAGEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTAT
Ga0318547_1023921023300031781SoilMKYALLIYAVPGASENPGPAAEGVIEGWLDYTAAIKDAGVLLGA
Ga0318552_1000430873300031782SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVRRGAEPR
Ga0318529_1029914123300031792SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLTWPD
Ga0318548_1017713913300031793SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATPVRLSEGERLLTDG
Ga0318548_1029616913300031793SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAI
Ga0318548_1047388223300031793SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVL
Ga0318523_1006054833300031798SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQLTWPDTATTIRLAD
Ga0318523_1028870223300031798SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQH
Ga0318565_1006272223300031799SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGELLGAEQLTG
Ga0318568_1001602453300031819SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLS
Ga0318564_1000124513300031831SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIMEAGVLLGAEQLTWPDTATTVR
Ga0318564_1015750213300031831SoilVKYALLIYATPGAAEGVRPADDGVIDSWLDYTAALKESGSLLAA
Ga0318564_1030843313300031831SoilMKYALLIYTVPGASENPGPAGEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATT
Ga0318499_1034215623300031832SoilMKYALLIYATPGAAEGVQPADDGVIDSWLDYTAALKESGVG
Ga0318495_1032529713300031860SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLT
Ga0306919_1106104313300031879SoilMKYALLIYAVPGASENPGPVPAGVIGDWLDYTAAIKEAGM
Ga0318536_1071012513300031893SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQLTWPDTATTIRLAEGERLL
Ga0318522_1019457823300031894SoilMEVRVKYALLIYATPGAAEGVRPADDGVIDSWLDYTA
Ga0318551_1018222513300031896SoilMKYALLIYAVPGAGENPGPAPAGVIESWLDYTAAIKEAGVGRGAAPLPRPP
Ga0318551_1030601423300031896SoilMKYALLIYATPGAAEGVQPADDGVIDSWLDYTAAMK
Ga0318520_1002226143300031897SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEHHTRPD
Ga0318520_1031372913300031897SoilMKYALLLYAAPGAAQGVQPADDGVMNSWLDYTAAMKESGVLLAA
Ga0306923_1021362433300031910SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAQQRTRPDTAPTVRLSDRARRL
Ga0310913_1011951633300031945SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGA
Ga0310910_1155410813300031946SoilVKYALLIYATPGAAEGVRPADDGVIDSWLDYTAALKESGS
Ga0310909_1010977933300031947SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLTWP
Ga0318562_1042498713300032008SoilMKYALLIYATPGAAEGVQPADDGVIDSWLDYTAALK
Ga0318563_1001558953300032009SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQHAC
Ga0318506_1053648113300032052SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAEQ
Ga0318570_1055492213300032054SoilMKYALLIYAVPGASENPGPAAEGVIEDWLDYTAAIKDAGVLLGAEQLTWPDTA
Ga0318575_1030908313300032055SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGELLGAE
Ga0318504_1041949323300032063SoilMEVRVKYALLIYATPGAAEGVRPADDGVIDSWLDYTAALK
Ga0318504_1062165513300032063SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVGRGGGQLTRPGPAP
Ga0318513_1028662713300032065SoilMKYALLIYAVPGAGDNPGPAPAGVIESWLDYTAAIKEAGVGGGGGEDHRR
Ga0318514_1006446933300032066SoilMKYALLIYAVPGASENPGPAPEGVIEDWHDYTAAIK
Ga0318514_1014202813300032066SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVRGGAAARTR
Ga0306924_1029071333300032076SoilMKYALLIYTVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWP
Ga0306924_1136744513300032076SoilMKYALLIYATPGAAEGVQPADDGVIDSWLDYTAALKESGVLL
Ga0318525_1001166213300032089SoilMKYALLIYAVPGASENPGPAPAGVIESWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLSD
Ga0318525_1023370623300032089SoilMKYALLIYAVPGAGENPGPAPAGVIEDWLDYTAAIKEAGMLLGAEQLTYPDTAT
Ga0307472_10206819713300032205Hardwood Forest SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATT
Ga0306920_10142550423300032261SoilMKYALLIYAVPGASENPGPAAEGVIEDWLDYTAAIKDAGVLLGAEQL
Ga0306920_10340483523300032261SoilMKYALLIYTVPGASENPGPAAEGVIDDWLDYTAAIKEAGVL
Ga0306920_10381979613300032261SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLT
Ga0310914_1042161613300033289SoilMKYALLIYAVPGASENPGPAAEGVIDDWLDYTAAIKEAGVLLGAEQLTWPDTATTVRLA
Ga0318519_1006592413300033290SoilMKYALLIYAVPGASENPGPAPEGVIEDWLDYTAAIKEAGVLLGAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.