NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094084

Metagenome Family F094084

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094084
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence MSAQPEVWRVSTVEGIFETDLETLKQWIVEGCVLPTDKVSKGNLS
Number of Associated Samples 93
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.11 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.40 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.283 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(44.340 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(62.264 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.70%    β-sheet: 19.18%    Coil/Unstructured: 67.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF09924LPG_synthase_C 7.55
PF00933Glyco_hydro_3 2.83
PF14714KH_dom-like 0.94
PF13290CHB_HEX_C_1 0.94
PF00756Esterase 0.94
PF01833TIG 0.94
PF01027Bax1-I 0.94
PF01551Peptidase_M23 0.94
PF00873ACR_tran 0.94
PF07676PD40 0.94
PF13365Trypsin_2 0.94
PF00565SNase 0.94
PF02866Ldh_1_C 0.94
PF00903Glyoxalase 0.94
PF13602ADH_zinc_N_2 0.94
PF00069Pkinase 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.77
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 2.83
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_11757128All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300000955|JGI1027J12803_108219997All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300002562|JGI25382J37095_10080224All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300004643|Ga0062591_101633309All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005093|Ga0062594_101581919All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005093|Ga0062594_101669882All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium664Open in IMG/M
3300005175|Ga0066673_10203237All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300005293|Ga0065715_10337715All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005334|Ga0068869_100174586All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1681Open in IMG/M
3300005334|Ga0068869_100487904All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1027Open in IMG/M
3300005339|Ga0070660_100064349All Organisms → cellular organisms → Bacteria2853Open in IMG/M
3300005345|Ga0070692_10161115All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300005355|Ga0070671_100234401All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300005364|Ga0070673_101609548All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005434|Ga0070709_10155176All Organisms → cellular organisms → Bacteria → Acidobacteria1586Open in IMG/M
3300005440|Ga0070705_101777936All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005459|Ga0068867_101207144All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005518|Ga0070699_102050298All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005536|Ga0070697_101866116All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005546|Ga0070696_100283437All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300005546|Ga0070696_101513129All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005556|Ga0066707_10935755All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005564|Ga0070664_102157779All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium529Open in IMG/M
3300005586|Ga0066691_10910015All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005618|Ga0068864_100985217All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300005618|Ga0068864_101529646All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005719|Ga0068861_101693331All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005834|Ga0068851_10573246All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005841|Ga0068863_101644182All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium652Open in IMG/M
3300005843|Ga0068860_101502211All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300005844|Ga0068862_102124150All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005983|Ga0081540_1217906All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006196|Ga0075422_10010515All Organisms → cellular organisms → Bacteria3007Open in IMG/M
3300006755|Ga0079222_10440198All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300006852|Ga0075433_10342568All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300006852|Ga0075433_11516455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia579Open in IMG/M
3300006880|Ga0075429_101363668All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006904|Ga0075424_100095662All Organisms → cellular organisms → Bacteria3127Open in IMG/M
3300006954|Ga0079219_10471593All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300007004|Ga0079218_11221523All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300009098|Ga0105245_11383691All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300009101|Ga0105247_11699022All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium522Open in IMG/M
3300009157|Ga0105092_10878801All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009162|Ga0075423_13208730All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009177|Ga0105248_11850851All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300009553|Ga0105249_10083605All Organisms → cellular organisms → Bacteria2971Open in IMG/M
3300009553|Ga0105249_11639468Not Available716Open in IMG/M
3300010373|Ga0134128_11014801All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300010397|Ga0134124_10648388All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1039Open in IMG/M
3300010397|Ga0134124_11116008All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300010400|Ga0134122_12517307All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010403|Ga0134123_10198245All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300010403|Ga0134123_10559607All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1090Open in IMG/M
3300010403|Ga0134123_11996731All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium638Open in IMG/M
3300011119|Ga0105246_10023196All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium4012Open in IMG/M
3300012022|Ga0120191_10156839All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012355|Ga0137369_10173322All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300012361|Ga0137360_11650934Not Available546Open in IMG/M
3300012517|Ga0157354_1036335All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012681|Ga0136613_10405860All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300012898|Ga0157293_10344103All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012948|Ga0126375_11858485All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012971|Ga0126369_11463526All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300013102|Ga0157371_11000492All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300013297|Ga0157378_10656912All Organisms → cellular organisms → Bacteria → Acidobacteria1065Open in IMG/M
3300013308|Ga0157375_13737283All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300014325|Ga0163163_10245376All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1841Open in IMG/M
3300014745|Ga0157377_11521006All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300014829|Ga0120104_1068795All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300015371|Ga0132258_11409403All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1760Open in IMG/M
3300015374|Ga0132255_103349506All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300018000|Ga0184604_10149771All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300018466|Ga0190268_11641223Not Available569Open in IMG/M
3300019377|Ga0190264_10288538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300019883|Ga0193725_1009333All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300022756|Ga0222622_11088435All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300025325|Ga0209341_10340354All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300025735|Ga0207713_1203718All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025904|Ga0207647_10315346All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium889Open in IMG/M
3300025908|Ga0207643_10229864All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300025908|Ga0207643_10382579All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium887Open in IMG/M
3300025910|Ga0207684_10587484All Organisms → cellular organisms → Bacteria → Proteobacteria952Open in IMG/M
3300025912|Ga0207707_10920152All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium722Open in IMG/M
3300025918|Ga0207662_10391908All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300025923|Ga0207681_11342967Not Available600Open in IMG/M
3300025925|Ga0207650_11543008All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025930|Ga0207701_10750523All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300025930|Ga0207701_11435251All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025938|Ga0207704_11334684All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300025942|Ga0207689_11214763All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300025945|Ga0207679_12067788All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium518Open in IMG/M
3300026035|Ga0207703_10651095All Organisms → cellular organisms → Bacteria → Acidobacteria999Open in IMG/M
3300026035|Ga0207703_10974618All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026088|Ga0207641_10821891All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium920Open in IMG/M
3300026118|Ga0207675_100018071All Organisms → cellular organisms → Bacteria → Acidobacteria6576Open in IMG/M
3300027639|Ga0209387_1106176Not Available694Open in IMG/M
3300027873|Ga0209814_10273336All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300031562|Ga0310886_10400431All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300031740|Ga0307468_102257444All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031740|Ga0307468_102539244All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031901|Ga0307406_11348029All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031911|Ga0307412_12094521All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031940|Ga0310901_10541748All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300032012|Ga0310902_10789089All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300032180|Ga0307471_103767916All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300033480|Ga0316620_10783578All Organisms → cellular organisms → Bacteria → Acidobacteria913Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.94%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.94%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.94%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1175712813300000789SoilMSAQPEIWRVSTIEGTFETDLETLKQWIVEGCVLPTDKVSKGTLNWID
JGI1027J12803_10821999713300000955SoilMSAQPEIWRVSTIEGTFETDLETLKQWIVEGCVLPTD
JGI25382J37095_1008022413300002562Grasslands SoilMSAQLEQWRVSTVEGVFETDLETLRQWITEGSVAPTDKVSKGNLNWIDAGRAPM
Ga0062591_10163330913300004643SoilMSAQPEIWRVSTIEGVFEADLETLRQWILEGCVQPTDKVTKGNLSWIE
Ga0062594_10158191913300005093SoilMSAQPEVWRVSTVEGIFETDLETLKQWISEGCVLPTDKVSKGTLNWIDAGRAPML
Ga0062594_10166988223300005093SoilMSAQPEVWRVSTVEGIFETDLETLKQWIVEGCVLPTDKVSKGNLS
Ga0066673_1020323713300005175SoilMSAQVEQWRVSTIAGVFETDLETLRQWITEGSVAPTDKVSKGNLNWIDAG
Ga0065715_1033771533300005293Miscanthus RhizosphereMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVSKGSLSWIDAGRVPKLKG
Ga0068869_10017458633300005334Miscanthus RhizosphereMSAQPEVWRVSTVEGIFETDLETLKQWIVEGCVLPTDKVS
Ga0068869_10048790413300005334Miscanthus RhizosphereMSTNPELWRVSTVEGLFETDLETLKQWIREDCVLPTDKVSKGNLNWIDAG
Ga0070660_10006434963300005339Corn RhizosphereMSAQPEVWRVSTVEGIFETDLETLRQWILEGCVLPTDKVSKGNLSWIDAGRVPKLKG
Ga0070692_1016111523300005345Corn, Switchgrass And Miscanthus RhizosphereMSAQPEVWRVSTVEGVFETDLETLKQWIVEGCVLPTDKVSK
Ga0070671_10023440113300005355Switchgrass RhizosphereMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVSKGSLSWIDAGR
Ga0070673_10160954813300005364Switchgrass RhizosphereMSAQPETWRVSTIEGVFEADLETLRQWILEGCVQPTDKVTKGNLNW
Ga0070709_1015517623300005434Corn, Switchgrass And Miscanthus RhizosphereMSAQPEIWRVSTYEGVFETDFQTLQQWIVEGCVLPTDKVSKGKLNWIE
Ga0070705_10177793613300005440Corn, Switchgrass And Miscanthus RhizosphereMSAQPETWRVSTIEGVFEADLETLRQWILEGCVQPTDKVTKGNLNWIE
Ga0068867_10120714413300005459Miscanthus RhizosphereMSAQQEQWRVSTVEGVFETDLDTLRQWILEGCVLPTDKVSKGTLNWI
Ga0070699_10205029823300005518Corn, Switchgrass And Miscanthus RhizosphereMSAQPEIWRVSTAEGVFETDVETLKQWIAEGCVLPTDKVSKGSLKWIEAGCAPM
Ga0070697_10186611613300005536Corn, Switchgrass And Miscanthus RhizosphereMSAQAETWRVSTVEGVFETDVETLKQWIAEGCVLPTDKVSKGSL
Ga0070696_10028343723300005546Corn, Switchgrass And Miscanthus RhizosphereMSAQPEVWRVSTVEGIFETDLDTLKQWIVEGCVLPTDKVSKGNLSWIEA
Ga0070696_10151312913300005546Corn, Switchgrass And Miscanthus RhizosphereMSAQAEIWRVSTAEGVFETDVETLKQWIAEGCVLPTDKVSKGSLKWIEAGCAPM
Ga0066707_1093575513300005556SoilMSAQLEQWRVNTVNGVFETDLETLQRWITEGSVAPTDK
Ga0070664_10215777923300005564Corn RhizosphereMSAQPELWRVSTIEGIFETDLETLKQWIVEGCVLPTDKVS
Ga0066691_1091001523300005586SoilMSAQVEQWRVSTVAGVFETDLETLRQWITEGSVAPTDKVSK
Ga0068864_10098521713300005618Switchgrass RhizosphereMSTTPELWRVSTVEGLFETDLETLKQWIREDCVLPTDKVSKGN
Ga0068864_10152964623300005618Switchgrass RhizosphereMSAQPELWRVSTIEGIFETDLETLKQWIVEGCVLPTD
Ga0068861_10169333113300005719Switchgrass RhizosphereMSAQLEQWRVNTPEGVLETDLETLRQWIAEGSILPTDKVSKGS
Ga0068851_1057324613300005834Corn RhizosphereMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVSKGSLSWIDAGRVPK
Ga0068863_10164418233300005841Switchgrass RhizosphereMSAQPELWRVSTIEGIFETDLETLKQWIVEGCVLPTDKVSKGNLSWI
Ga0068860_10150221123300005843Switchgrass RhizosphereMSAQPEIWRVSTYEGVFETDFQTLQQWIVEGCVLPT
Ga0068862_10212415013300005844Switchgrass RhizosphereMSTNPELWRVSTVEGLFETDLETLKQWIREDCVLPTDKVSKGNLNWIDAGR
Ga0081540_121790623300005983Tabebuia Heterophylla RhizosphereMSAQPEVWRVSTVEGVFETDLDTLRQWILEGCVLPTDKVSKGN
Ga0075422_1001051543300006196Populus RhizosphereMSAQPEVWRVNTVEGIFETDLETLKQWIVEGCVLPT
Ga0079222_1044019823300006755Agricultural SoilMSAQPEVWRVSTVEGIFETDLETLKQWIGEGCVLPTDKVSKGNLSWI
Ga0075433_1034256813300006852Populus RhizosphereMSAQPEVWRVSTIEGIFETDLETLKQWILEGCVLPTDKVSKGNLSWIDAGR
Ga0075433_1151645513300006852Populus RhizosphereMSAQPEVWRVSTIEGIFETDLETLKQWIVEGCVLPTDKVSKGNLSWI
Ga0075429_10136366823300006880Populus RhizosphereMSAQPEVWRVSTVEGIFETDLETLKQWIIEGCVLPTDKVSKGNLSWID
Ga0075424_10009566213300006904Populus RhizosphereMSAQPEVWRVSTIEGIFETDLETLKQWILEGCVLPTDKVSKGNLSWIDAGRVPK
Ga0079219_1047159313300006954Agricultural SoilMSAQPEVWRVSTVEGVFETDLETLKQWILEGCVLPTDKVSKGNLGWIE
Ga0079218_1122152323300007004Agricultural SoilMSAQVELWRVSTVEGTFETDLETLKQWIAEGCVLPTDKVSKGNL
Ga0105245_1138369123300009098Miscanthus RhizosphereMSTTPELWRVSTVEGLFETDLETLKQWIREDCVLP
Ga0105247_1169902213300009101Switchgrass RhizosphereMSAQPAVRRVGPPDGIFEADLEQLDQSIIEGCVLPTDKVTKGNLSWI
Ga0105092_1087880113300009157Freshwater SedimentMSAQPETWRVSTIEGVFEADLETLRQWILEGCVQPTDK
Ga0075423_1320873013300009162Populus RhizosphereMSAQPEIWRVSTVEGVFETDLETLKQWIAEGCVLPTDKVSKGSLNWI
Ga0105248_1185085113300009177Switchgrass RhizosphereMSAQPEVWRVSTIEGVFETDLETLKQWIAEGCVLPTDK
Ga0105249_1008360523300009553Switchgrass RhizosphereMSAQPEIWRVSTYEGVFETDFQTLQQWIVEGCVLPTD
Ga0105249_1163946813300009553Switchgrass RhizosphereMSAQTEIWRVSTAKGTFETDLESLIQRIVEGTVLPTDKVSKGNLSWIE
Ga0134128_1101480123300010373Terrestrial SoilMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVS
Ga0134124_1064838823300010397Terrestrial SoilMSAQPEVWRVSTVEGVFETDLETLKQWIVEGCVLPTDKVS
Ga0134124_1111600813300010397Terrestrial SoilMSAQPEVWRVSTVEGIFETDLETLRQWILEGCVLPTDKVSKGNLS
Ga0134122_1251730713300010400Terrestrial SoilMSAQPETWRVSTIEGVFEADLETLRQWILEGCVQPTD
Ga0134123_1019824523300010403Terrestrial SoilMSAQPEVWRVSTVEGIFEADLETLKQWIVEGCVLPTDKVTKGNLSWIE
Ga0134123_1055960723300010403Terrestrial SoilMSAQVEQWRVNTPEGIFETDLETLQQWIVEGCVLPSDKVCKGKLSWIEAGKA
Ga0134123_1199673123300010403Terrestrial SoilMSAQPEVWRVSTVEGIFETDLETLQQWIVEGCVLPTDKVCKGNLSWIDAGRVP
Ga0105246_1002319623300011119Miscanthus RhizosphereMTDQSELWRVSTPEGIFEANLETLKQWISEGCVIPTDKVTKGNLNW
Ga0120191_1015683923300012022TerrestrialMSAQPEIWRVSTIEGVFEADLETLKQWIHEGCVLPTDKVSKGSLNWI
Ga0137369_1017332213300012355Vadose Zone SoilMSAQLEQWRVSTIDGVFETDLETLRQWISEGAVAPTDKVSKGKLNWIDAGRAP
Ga0137360_1165093413300012361Vadose Zone SoilMSAQIEQWRVSTPTGVFEADLETLKEWIADGSVAPTDKVSKGSLNWIE
Ga0157354_103633513300012517Unplanted SoilMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVSKGNLSWIDAG
Ga0136613_1040586013300012681Polar Desert SandMMSAEVEKWRVSTIEGVFEADLDTLKQWIHEGCVLPTD
Ga0157293_1034410313300012898SoilMSAQPEQWRVSTVEGIFEADLETLKQWIIEGAVLPTDKVSKGTLNW
Ga0126375_1185848513300012948Tropical Forest SoilMSAQPEVWRVSTVEGVFETDLDTLKQWIHEGAVLPTDKVSKGNLSWIDAGKAPMLKA
Ga0126369_1146352623300012971Tropical Forest SoilMSAPLQQWRVSTPTGVFEADLETLRQWISEGAVLPTDKVSKG
Ga0157371_1100049213300013102Corn RhizosphereMSTNPELWRVSTVEGLFETDLETLKQWIREDGALPTDKVSKG
Ga0157378_1065691223300013297Miscanthus RhizosphereMSAQPEIWRVSTYEGVFETDFQTLQQWIVEGCVLPTDKV
Ga0157375_1373728313300013308Miscanthus RhizosphereMTDQSELWRVSTPEGIFEANLETLKQWISEGCVIPTD
Ga0163163_1024537633300014325Switchgrass RhizosphereMSAQPEVWRVSTVEGIFETDLETLQQWIVEGCVLPTDKVCKGNLSWIDAGRVPKL
Ga0157377_1152100613300014745Miscanthus RhizosphereMSAQPEVWRVSTVEGIFETDLETLRQWILEGCVLPTD
Ga0120104_106879513300014829PermafrostMSAQVELWRVSTVEGEFETDLETLKQWIVEGCVLPTDKVSKGNLNWTDAGRAPML
Ga0132258_1140940323300015371Arabidopsis RhizosphereMSTNPEVWRVSTVEGLFEPDLETLKQWIREDCVLPTDKVSKG
Ga0132255_10334950613300015374Arabidopsis RhizosphereMSAQPEVWRVSTAEGVFETDLETLRQWILEGCVLPTDKVCKGSQSWIDAGRVP
Ga0184604_1014977123300018000Groundwater SedimentMSAQPGQWRVSTIEGVFEADLETLKQWIAEGCVQPTDKVSKGNLNWIEAG
Ga0190268_1164122313300018466SoilMSAQVELWRVQTAEGVFEADLETLRQWIAEGAVVRSDK
Ga0190264_1028853823300019377SoilMSAQVELWRVSTAEGVFEADLETLKQWIAEGCVLPTDKVS
Ga0193725_100933313300019883SoilMSAQLEQWRVSTVDGEFETDLETLRLWISEGAVAPTDKVSKGKLSWI
Ga0222622_1108843513300022756Groundwater SedimentMSAQVETWRVDTIEGIFETDLDTLKQWIAEGCVLPTDKVS
Ga0209341_1034035423300025325SoilMSAQVEVWRVITPEGTFETDLETLKQWIAEGCVVS
Ga0207713_120371813300025735Switchgrass RhizosphereMSAQPEVWRVSTIEGVFETDLETLQQWIVEGCVLPTDKVCK
Ga0207647_1031534613300025904Corn RhizosphereMTDQSELWRVSTPEGIFEANLETLKQWISEGCVVPTDKVTKG
Ga0207643_1022986413300025908Miscanthus RhizosphereMSAQPEVWRVSTVEGIFEADLETHKQWIVEGCVLPTDKVTKGNLSWI
Ga0207643_1038257913300025908Miscanthus RhizosphereMTDQSELWRVSTPEGVFEANLETLKQWISEGCVIPTDKVT
Ga0207684_1058748423300025910Corn, Switchgrass And Miscanthus RhizosphereMSAQPESWRVSTVEGVFETDLETLKQWIIEGCVLPTDKVSKGNLNWIE
Ga0207707_1092015213300025912Corn RhizosphereMSAQPEVWRVSTIEGVFETDFETLKQWIVEGCVLPTDKVSKGNLSWIE
Ga0207662_1039190823300025918Switchgrass RhizosphereMSAQPEVWRVSTVEGIFEADLETLKQWIVEGCVLPTDKVTK
Ga0207681_1134296723300025923Switchgrass RhizosphereMSAQVELWRVSTAEGVFETDLETLKQWIMEGCVLPTDKVS
Ga0207650_1154300823300025925Switchgrass RhizosphereMSAQPETWRVNTPEGIFETDLETLKQWILEGCVLPT
Ga0207701_1075052313300025930Corn, Switchgrass And Miscanthus RhizosphereMSAQPETWRVSTIEGIFETDLETLKQWIVEGCVLPT
Ga0207701_1143525113300025930Corn, Switchgrass And Miscanthus RhizosphereMSAQPEMWRVSTIEGVFETDLETLKQWIVEGCVLPTDKVSKGSLSWIDAGRVPKL
Ga0207704_1133468413300025938Miscanthus RhizosphereMSAQPETWRVSTIEGVFEADLETLRQWILEGCVQPTDKVTKGNLNWI
Ga0207689_1121476323300025942Miscanthus RhizosphereMSAQPEVWRVSTIEGIFETDLETLKQWIVEGCVLPTDKVSKG
Ga0207679_1206778823300025945Corn RhizosphereMSAQPDVWRVSTPEGIFETDLETLKQWIIEGCVLPTDKVTKGNLSWI
Ga0207703_1065109523300026035Switchgrass RhizosphereSTVEGIFETDLETLRQWILEGCVLPTDKVCKGKLSWIDAGRV
Ga0207703_1097461813300026035Switchgrass RhizosphereMSAQPEVWRVSTVEGIFETDLETLRQWILEGCVLPTDKVCKGKLSWIDAGRVPKL
Ga0207641_1082189113300026088Switchgrass RhizosphereMSAQPEVWRVSTVEGIFETDLETLQQWIVEGCVLPTDKVSKG
Ga0207675_10001807133300026118Switchgrass RhizosphereMSAQPEVWRVSTVEGIFETDLETLKQWISEGCVLPTDKVSKGTLN
Ga0209387_110617623300027639Agricultural SoilMSAQVEVWRVSTVEGVFETDLDTLRQWIVEGSVLPTDKVS
Ga0209814_1027333623300027873Populus RhizosphereMSAQPEIWRVSTVEGIFETDLETLKQWISEGCVLPTDKVSKGTLNW
Ga0310886_1040043113300031562SoilMSAQPEVWRVSTVEGIFETDLETLKQWISEGCVLPTDKVSKATLN
Ga0307468_10225744413300031740Hardwood Forest SoilMSAQPEVWRVSTIEGVFETDFETLKQWIVEGCVLPTDKVSKGNLSWIEAG
Ga0307468_10253924413300031740Hardwood Forest SoilMSTQVEKWRVDTVEGIFETDLDTLKQWISEGCVLPTDK
Ga0307406_1134802913300031901RhizosphereMSAQPETWRVNTPEGIFETDLETLKQWILEGCVLPTDKVSKGNLSWIDAGRVPKLK
Ga0307412_1209452123300031911RhizosphereMSAQPEVWRVSTSEGVFEADLETLKQWIVEGCVLPTDKVTKRNQSWI
Ga0310901_1054174813300031940SoilMSAQPEVWRVSTVEGIFETDLETLKQWIAEGCVQPTDKVSKGTLNW
Ga0310902_1078908913300032012SoilMSAQHEVWRVSTVEGIFETDLETLKQWISEGCVLPTDKVSKGTLNW
Ga0307471_10376791613300032180Hardwood Forest SoilMSAQPEIWRVNTAEGVFETDVETLKQWIAEGCVLPTDKVSKGSLKWIDAGC
Ga0316620_1078357823300033480SoilMSAQPEVWRVSTVEGVFETDLDTLKQWISEGSVLPTDKVSK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.