


| Basic Information | |
|---|---|
| Family ID | F093908 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.94 % |
| % of genes near scaffold ends (potentially truncated) | 51.89 % |
| % of genes from short scaffolds (< 2000 bps) | 82.08 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.774 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (26.415 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.453 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (99.057 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.44% β-sheet: 6.67% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02912 | Phe_tRNA-synt_N | 50.94 |
| PF00453 | Ribosomal_L20 | 20.75 |
| PF01632 | Ribosomal_L35p | 10.38 |
| PF01588 | tRNA_bind | 3.77 |
| PF00707 | IF3_C | 3.77 |
| PF03129 | HGTP_anticodon | 2.83 |
| PF05198 | IF3_N | 2.83 |
| PF03484 | B5 | 1.89 |
| PF04290 | DctQ | 0.94 |
| PF03483 | B3_4 | 0.94 |
| PF13508 | Acetyltransf_7 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 50.94 |
| COG0292 | Ribosomal protein L20 | Translation, ribosomal structure and biogenesis [J] | 20.75 |
| COG0291 | Ribosomal protein L35 | Translation, ribosomal structure and biogenesis [J] | 10.38 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 6.60 |
| COG0073 | tRNA-binding EMAP/Myf domain | Translation, ribosomal structure and biogenesis [J] | 3.77 |
| COG2517 | Predicted RNA-binding protein, contains C-terminal EMAP domain | General function prediction only [R] | 3.77 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.77 % |
| Unclassified | root | N/A | 46.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001346|JGI20151J14362_10066407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1437 | Open in IMG/M |
| 3300001347|JGI20156J14371_10032997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2480 | Open in IMG/M |
| 3300001943|GOS2226_1018610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1770 | Open in IMG/M |
| 3300003216|JGI26079J46598_1039001 | Not Available | 1024 | Open in IMG/M |
| 3300003345|JGI26080J50196_1012812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2379 | Open in IMG/M |
| 3300003617|JGI26082J51739_10018117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 3070 | Open in IMG/M |
| 3300003620|JGI26273J51734_10062432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1130 | Open in IMG/M |
| 3300003683|Ga0008459J53047_1005970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 751 | Open in IMG/M |
| 3300004279|Ga0066605_10080836 | Not Available | 1387 | Open in IMG/M |
| 3300005837|Ga0078893_10272908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1783 | Open in IMG/M |
| 3300005837|Ga0078893_10280797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 631 | Open in IMG/M |
| 3300006026|Ga0075478_10060462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1233 | Open in IMG/M |
| 3300006400|Ga0075503_1188532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 699 | Open in IMG/M |
| 3300006400|Ga0075503_1686318 | Not Available | 594 | Open in IMG/M |
| 3300006403|Ga0075514_1219798 | Not Available | 510 | Open in IMG/M |
| 3300006403|Ga0075514_1219988 | Not Available | 510 | Open in IMG/M |
| 3300007543|Ga0102853_1033445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 873 | Open in IMG/M |
| 3300007954|Ga0105739_1051672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 895 | Open in IMG/M |
| 3300009071|Ga0115566_10314263 | Not Available | 921 | Open in IMG/M |
| 3300009193|Ga0115551_1030759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2741 | Open in IMG/M |
| 3300009193|Ga0115551_1470604 | Not Available | 537 | Open in IMG/M |
| 3300009476|Ga0115555_1070471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1537 | Open in IMG/M |
| 3300009495|Ga0115571_1226528 | Not Available | 757 | Open in IMG/M |
| 3300009505|Ga0115564_10621827 | Not Available | 507 | Open in IMG/M |
| 3300009507|Ga0115572_10472021 | Not Available | 697 | Open in IMG/M |
| 3300009677|Ga0115104_10696901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 651 | Open in IMG/M |
| 3300010300|Ga0129351_1128247 | Not Available | 1009 | Open in IMG/M |
| 3300012504|Ga0129347_1242405 | Not Available | 780 | Open in IMG/M |
| 3300016727|Ga0182051_1024790 | Not Available | 860 | Open in IMG/M |
| 3300016729|Ga0182056_1146814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
| 3300016746|Ga0182055_1064321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4848 | Open in IMG/M |
| 3300016746|Ga0182055_1328463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300016776|Ga0182046_1206417 | Not Available | 567 | Open in IMG/M |
| 3300017697|Ga0180120_10212248 | Not Available | 798 | Open in IMG/M |
| 3300017824|Ga0181552_10440161 | Not Available | 620 | Open in IMG/M |
| 3300017950|Ga0181607_10353979 | Not Available | 811 | Open in IMG/M |
| 3300017957|Ga0181571_10413329 | Not Available | 834 | Open in IMG/M |
| 3300017957|Ga0181571_10414108 | Not Available | 833 | Open in IMG/M |
| 3300018416|Ga0181553_10067746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2294 | Open in IMG/M |
| 3300018417|Ga0181558_10394913 | Not Available | 735 | Open in IMG/M |
| 3300018423|Ga0181593_10200069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1576 | Open in IMG/M |
| 3300018428|Ga0181568_10089323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2593 | Open in IMG/M |
| 3300018428|Ga0181568_10526230 | Not Available | 939 | Open in IMG/M |
| 3300019262|Ga0182066_1153024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 916 | Open in IMG/M |
| 3300019271|Ga0182065_1425756 | Not Available | 792 | Open in IMG/M |
| 3300019276|Ga0182067_1557221 | Not Available | 783 | Open in IMG/M |
| 3300019283|Ga0182058_1036847 | Not Available | 600 | Open in IMG/M |
| 3300019765|Ga0194024_1062025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300020165|Ga0206125_10068244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300020173|Ga0181602_10152824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
| 3300020175|Ga0206124_10343121 | Not Available | 563 | Open in IMG/M |
| 3300020176|Ga0181556_1170782 | Not Available | 865 | Open in IMG/M |
| 3300020178|Ga0181599_1219719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300020187|Ga0206130_10056205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2718 | Open in IMG/M |
| 3300020191|Ga0181604_10313289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300020191|Ga0181604_10440922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha3_Bin3 | 550 | Open in IMG/M |
| 3300020385|Ga0211677_10000709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 29982 | Open in IMG/M |
| 3300020469|Ga0211577_10082191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2266 | Open in IMG/M |
| 3300021185|Ga0206682_10325109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300021350|Ga0206692_1060824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300021375|Ga0213869_10091132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1500 | Open in IMG/M |
| 3300021389|Ga0213868_10045043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3114 | Open in IMG/M |
| 3300021958|Ga0222718_10000132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 73623 | Open in IMG/M |
| 3300022921|Ga0255765_1224539 | Not Available | 807 | Open in IMG/M |
| 3300022929|Ga0255752_10066427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 2130 | Open in IMG/M |
| 3300023108|Ga0255784_10073872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1990 | Open in IMG/M |
| 3300023555|Ga0232120_102994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 831 | Open in IMG/M |
| 3300023679|Ga0232113_1017661 | Not Available | 755 | Open in IMG/M |
| 3300023683|Ga0228681_1043924 | Not Available | 529 | Open in IMG/M |
| 3300023696|Ga0228687_1011214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 987 | Open in IMG/M |
| 3300023704|Ga0228684_1033087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 795 | Open in IMG/M |
| 3300023706|Ga0232123_1097229 | Not Available | 549 | Open in IMG/M |
| 3300023706|Ga0232123_1103914 | Not Available | 526 | Open in IMG/M |
| 3300024242|Ga0228673_1065480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 644 | Open in IMG/M |
| 3300024248|Ga0228676_1043894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1022 | Open in IMG/M |
| 3300024296|Ga0228629_1119566 | Not Available | 697 | Open in IMG/M |
| 3300024318|Ga0233400_1044099 | Not Available | 1155 | Open in IMG/M |
| 3300025610|Ga0208149_1109698 | Not Available | 656 | Open in IMG/M |
| 3300025621|Ga0209504_1141331 | Not Available | 583 | Open in IMG/M |
| 3300025626|Ga0209716_1107141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 785 | Open in IMG/M |
| 3300025658|Ga0209659_1046307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1624 | Open in IMG/M |
| 3300025828|Ga0208547_1043329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1606 | Open in IMG/M |
| 3300025828|Ga0208547_1158238 | Not Available | 641 | Open in IMG/M |
| 3300025869|Ga0209308_10029939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3124 | Open in IMG/M |
| 3300025874|Ga0209533_1322760 | Not Available | 586 | Open in IMG/M |
| 3300025881|Ga0209309_10266787 | Not Available | 787 | Open in IMG/M |
| 3300025886|Ga0209632_10019280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4988 | Open in IMG/M |
| 3300025892|Ga0209630_10409622 | Not Available | 584 | Open in IMG/M |
| 3300025897|Ga0209425_10315250 | Not Available | 778 | Open in IMG/M |
| 3300026398|Ga0247606_1007349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
| 3300026423|Ga0247580_1035481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1100 | Open in IMG/M |
| 3300026426|Ga0247570_1048965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 893 | Open in IMG/M |
| 3300026427|Ga0247556_1012006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1829 | Open in IMG/M |
| 3300026443|Ga0247559_1098289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 610 | Open in IMG/M |
| 3300026448|Ga0247594_1006458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1729 | Open in IMG/M |
| 3300026462|Ga0247568_1049921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 814 | Open in IMG/M |
| 3300026466|Ga0247598_1156136 | Not Available | 540 | Open in IMG/M |
| 3300026503|Ga0247605_1126615 | Not Available | 618 | Open in IMG/M |
| 3300026503|Ga0247605_1159159 | Not Available | 541 | Open in IMG/M |
| 3300026511|Ga0233395_1146926 | Not Available | 559 | Open in IMG/M |
| 3300028095|Ga0247563_1048576 | Not Available | 855 | Open in IMG/M |
| 3300028337|Ga0247579_1020931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1313 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 26.42% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 24.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.38% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.38% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.66% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.77% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.83% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.89% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.94% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300003683 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016727 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016729 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019271 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023555 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023679 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023683 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023696 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024318 | Seawater microbial communities from Monterey Bay, California, United States - 46D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026398 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026423 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026426 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026427 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026443 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300028095 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028337 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20151J14362_100664071 | 3300001346 | Pelagic Marine | MIQKKVGLKKTSRCDRSGQINHGQNQSFFLAPVNTTARLS |
| JGI20156J14371_100329972 | 3300001347 | Pelagic Marine | MIQKXVGLKKTXRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| GOS2226_10186104 | 3300001943 | Marine | MIQKEVGLKKTSRRDRSGQVNHGQNQSFFLAPVNTTARLLSRILG* |
| JGI26079J46598_10390012 | 3300003216 | Marine | MIQKEVGLKKTSRRDRSRQINHGQNQSFFLAPVNTTARLSSRILG |
| JGI26080J50196_10128124 | 3300003345 | Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| JGI26082J51739_100181171 | 3300003617 | Marine | MIQKEVGLKKTSRRDRSRQINHGQNQSFFLAPVNTTARLSSRIL |
| JGI26273J51734_100624323 | 3300003620 | Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF* |
| Ga0008459J53047_10059703 | 3300003683 | Seawater | FTIGRHMIQKEAGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0066605_100808362 | 3300004279 | Marine | MIQKEVGLKKTSRRDRSRQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF* |
| Ga0078893_102729082 | 3300005837 | Marine Surface Water | MIQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0078893_102807972 | 3300005837 | Marine Surface Water | MIQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF* |
| Ga0075478_100604622 | 3300006026 | Aqueous | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0075509_15160873 | 3300006390 | Aqueous | QGFALHFTIGRHMIQKEVGLKETSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0075503_11885322 | 3300006400 | Aqueous | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0075503_16863181 | 3300006400 | Aqueous | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNT |
| Ga0075506_10173441 | 3300006401 | Aqueous | FLKIRHQGFSLYFTIGRHMTQKKAGLKKTSRRDHSGQINHGQNQSFFLAPVNTTARISSRILGRSLACRF* |
| Ga0075514_12197981 | 3300006403 | Aqueous | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGR |
| Ga0075514_12199881 | 3300006403 | Aqueous | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGR |
| Ga0102853_10334452 | 3300007543 | Estuarine | MTQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0105739_10516723 | 3300007954 | Estuary Water | MIQKEAGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0115566_103142632 | 3300009071 | Pelagic Marine | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSR |
| Ga0115551_10307593 | 3300009193 | Pelagic Marine | MTQKKAGLKKTSRRDHSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0115551_14706041 | 3300009193 | Pelagic Marine | MIQKEVGLKRTSRRDRSRQINHGQNQSFFLALVNTTARLSSRILG* |
| Ga0115555_10704714 | 3300009476 | Pelagic Marine | MIQKKVGLKKTSRCDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0115571_12265281 | 3300009495 | Pelagic Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTAR |
| Ga0115564_106218272 | 3300009505 | Pelagic Marine | KKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0115572_104720211 | 3300009507 | Pelagic Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRI |
| Ga0115104_106969011 | 3300009677 | Marine | IQKELGLKKTSHRDRSGQINHGQNQSFFLAPVNTTARLSSRILG* |
| Ga0129351_11282472 | 3300010300 | Freshwater To Marine Saline Gradient | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRFWDDP* |
| Ga0129347_12424052 | 3300012504 | Aqueous | MTQKKAGLKKTSRRDHSGQINHGQNQSFFLAPVNTTARLSSRFWDDP* |
| Ga0182051_10247902 | 3300016727 | Salt Marsh | MIQKEVVLKKTSRRDRSGRINHGQNQSFFLAPVNTTARLSSRFWDDP |
| Ga0182056_11468144 | 3300016729 | Salt Marsh | MIQKEVGLKETSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0182055_10643215 | 3300016746 | Salt Marsh | MIQKKVGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0182055_13284633 | 3300016746 | Salt Marsh | RSEQEVSFKKMSRCDHSRQINHGQNQSFFLAPVNTTAHLSSRFLG |
| Ga0182046_12064171 | 3300016776 | Salt Marsh | MIQKEVGLKETSRRDRSGQINHGQNQSFFLAPVNTTARLS |
| Ga0180120_102122481 | 3300017697 | Freshwater To Marine Saline Gradient | MIQKKVGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRIL |
| Ga0181552_104401611 | 3300017824 | Salt Marsh | VGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRIL |
| Ga0181607_103539791 | 3300017950 | Salt Marsh | VGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSR |
| Ga0181571_104133291 | 3300017957 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLA |
| Ga0181571_104141081 | 3300017957 | Salt Marsh | VGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLA |
| Ga0181553_100677464 | 3300018416 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0181558_103949131 | 3300018417 | Salt Marsh | VGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRI |
| Ga0181593_102000691 | 3300018423 | Salt Marsh | VGLKKTSRRDRSGQINHGRNQSFFLAPVNTTARLSSRIL |
| Ga0181568_100893231 | 3300018428 | Salt Marsh | KKVGFKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0181568_105262301 | 3300018428 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSL |
| Ga0182066_11530242 | 3300019262 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0182065_14257561 | 3300019271 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSS |
| Ga0182067_15572211 | 3300019276 | Salt Marsh | VGLKETSRRDRSGQINHGQNQSFFLAPVNTTARLS |
| Ga0182058_10368471 | 3300019283 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRFWDDP |
| Ga0194024_10620253 | 3300019765 | Freshwater | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0206125_100682441 | 3300020165 | Seawater | LKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0181602_101528244 | 3300020173 | Salt Marsh | KEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0206124_103431211 | 3300020175 | Seawater | MIQKEVGLKRTSRRDRSRQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0181556_11707821 | 3300020176 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLAC |
| Ga0181599_12197193 | 3300020178 | Salt Marsh | KKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0206130_100562055 | 3300020187 | Seawater | MIQKEVDLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0181604_103132893 | 3300020191 | Salt Marsh | VGLQKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0181604_104409221 | 3300020191 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRPLACRF |
| Ga0211677_100007095 | 3300020385 | Marine | MIQKEVGLKKTSRRDRSGQIQHGQNQSLFLAPVNTTARLSSRILG |
| Ga0211577_100821914 | 3300020469 | Marine | MTQKEVGLKKTSRCDRGGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0206682_103251092 | 3300021185 | Seawater | MIQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0206692_10608242 | 3300021350 | Seawater | MIPKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0213869_1000178313 | 3300021375 | Seawater | HQGFALYFTIGRHMIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0213869_100911321 | 3300021375 | Seawater | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0213868_100450431 | 3300021389 | Seawater | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARL |
| Ga0222718_1000013243 | 3300021958 | Estuarine Water | MIQKEVGLKKTSRRDRSRQINHGQNQSFFLAPVNTTARLSSRILGRSLACRF |
| Ga0255765_12245392 | 3300022921 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRS |
| Ga0255752_100664273 | 3300022929 | Salt Marsh | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSR |
| Ga0255784_100738725 | 3300023108 | Salt Marsh | IGRHTIQKEVGLKETSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0232120_1029941 | 3300023555 | Seawater | ALCFTIGRHMIQKEAGLKKTSRRDRSGPINHGQNQSFFLAPVNTTACLSSRILG |
| Ga0232113_10176612 | 3300023679 | Seawater | MTQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0228681_10439242 | 3300023683 | Seawater | MIQKEVGLKKTSRSDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0228687_10112142 | 3300023696 | Seawater | MIQKEVGFKKKSHRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0228684_10330872 | 3300023704 | Seawater | MTQKEMGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0232123_10972292 | 3300023706 | Salt Marsh | MIQKEVGLKKTGRRDRSGQINHGQNQSFFLAPVNTTARLSSRILGRS |
| Ga0232123_11039141 | 3300023706 | Salt Marsh | MIQKKVGFKKTSRRDRSGQINHGQNQSFFLAPVNTTAR |
| Ga0228673_10654802 | 3300024242 | Seawater | MIQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRVLG |
| Ga0228676_10438942 | 3300024248 | Seawater | MIQKEVGLKKKSRHDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0228629_11195663 | 3300024296 | Seawater | MIQKELGLKKTSRRDRSGQIQHGQNQSLFLAPVNTTARLSSRILG |
| Ga0233400_10440992 | 3300024318 | Seawater | MIQKEEGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0228652_11087883 | 3300024326 | Seawater | HQGFALYFTIGRHMIQKEVGLKKTSRRDRSGQVNHGQNQSFFLAPVNTTARLSSRILG |
| Ga0208149_11096982 | 3300025610 | Aqueous | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARL |
| Ga0209504_11413311 | 3300025621 | Pelagic Marine | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSS |
| Ga0209716_11071411 | 3300025626 | Pelagic Marine | MIQKEAGLKKTSRRDRSGQVNHGQNQSFFLAPVNTTARLSSRILG |
| Ga0209659_10463071 | 3300025658 | Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTA |
| Ga0208547_10433293 | 3300025828 | Aqueous | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRFWDDP |
| Ga0208547_11582381 | 3300025828 | Aqueous | MTQKKAGLKKTSRRDHSGQINHGQNQSFFLAPVNTTARISSRILG |
| Ga0209308_100299395 | 3300025869 | Pelagic Marine | MFQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0209533_13227601 | 3300025874 | Pelagic Marine | MTQKKAGLKKTSRRDHSGQINHGQNQSFFLAPVNTTA |
| Ga0209309_102667871 | 3300025881 | Pelagic Marine | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSS |
| Ga0209632_100192804 | 3300025886 | Pelagic Marine | MIQKKVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0209630_104096221 | 3300025892 | Pelagic Marine | MIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRIL |
| Ga0209425_103152501 | 3300025897 | Pelagic Marine | MIQKKVGLKKTNRRDRSGQINHGQNQSFFLAPVNTTAR |
| Ga0247606_10073493 | 3300026398 | Seawater | MIQKEVGWKKTSRHDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247580_10354812 | 3300026423 | Seawater | MIQKEAGLKKTSRRDRSGQINHGQNQSFFLAPVNTTACLSSRILG |
| Ga0247570_10489651 | 3300026426 | Seawater | LYFTIGRHMTQKEMGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247556_10120064 | 3300026427 | Seawater | VIQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247559_10982891 | 3300026443 | Seawater | GLKKTNRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247594_10064582 | 3300026448 | Seawater | MIQKEVGLRKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247568_10499212 | 3300026462 | Seawater | MIQKEVGFKKKSHRDRSGQIKHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247598_11561361 | 3300026466 | Seawater | MTQKEMGLKKTSRRDRSGQINHGQNQSFFLAPVNTT |
| Ga0247605_11266151 | 3300026503 | Seawater | VIQKEVGLKKTSHRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247605_11591591 | 3300026503 | Seawater | MTQKEVGLKKTSRCDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0233395_11469262 | 3300026511 | Seawater | IQKEVGLKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247563_10485764 | 3300028095 | Seawater | FALYFTIGRHMIQKEVGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| Ga0247579_10209314 | 3300028337 | Seawater | LIFLGVKKTSRRDRSGQINHGQNQSFFLAPVNTTARLSSRILG |
| ⦗Top⦘ |