NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093608

Metagenome / Metatranscriptome Family F093608

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093608
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 42 residues
Representative Sequence VIDPAALQMVLGVLTGWLDRREREAVAYLIEENRLLRRQLG
Number of Associated Samples 83
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.33 %
% of genes near scaffold ends (potentially truncated) 61.32 %
% of genes from short scaffolds (< 2000 bps) 83.02 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.962 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(14.151 % of family members)
Environment Ontology (ENVO) Unclassified
(26.415 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.736 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.62%    β-sheet: 0.00%    Coil/Unstructured: 46.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF13276HTH_21 9.43
PF13683rve_3 3.77
PF00903Glyoxalase 1.89
PF00753Lactamase_B 1.89
PF02687FtsX 1.89
PF01527HTH_Tnp_1 1.89
PF13432TPR_16 0.94
PF01168Ala_racemase_N 0.94
PF13489Methyltransf_23 0.94
PF00108Thiolase_N 0.94
PF00400WD40 0.94
PF07691PA14 0.94
PF04820Trp_halogenase 0.94
PF16576HlyD_D23 0.94
PF00486Trans_reg_C 0.94
PF13570PQQ_3 0.94
PF06296RelE 0.94
PF00665rve 0.94
PF02371Transposase_20 0.94
PF13360PQQ_2 0.94
PF14559TPR_19 0.94
PF13333rve_2 0.94
PF12728HTH_17 0.94
PF00160Pro_isomerase 0.94
PF00313CSD 0.94
PF08448PAS_4 0.94
PF01638HxlR 0.94
PF13560HTH_31 0.94
PF07676PD40 0.94
PF12681Glyoxalase_2 0.94
PF00999Na_H_Exchanger 0.94
PF07638Sigma70_ECF 0.94
PF01548DEDD_Tnp_IS110 0.94
PF14361RsbRD_N 0.94
PF03051Peptidase_C1_2 0.94
PF00483NTP_transferase 0.94
PF13442Cytochrome_CBB3 0.94
PF13453zf-TFIIB 0.94
PF03625DUF302 0.94
PF07394DUF1501 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 1.89
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.94
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.94
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.94
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.94
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.94
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.94
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.94
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.94
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.94
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.94
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.94
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.94
COG3579Aminopeptidase CAmino acid transport and metabolism [E] 0.94
COG4584TransposaseMobilome: prophages, transposons [X] 0.94
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.94
COG4737Uncharacterized conserved proteinFunction unknown [S] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.96 %
UnclassifiedrootN/A16.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10366703All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300004463|Ga0063356_104904559All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005093|Ga0062594_100482537All Organisms → cellular organisms → Bacteria → Acidobacteria1040Open in IMG/M
3300005332|Ga0066388_101973113All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005338|Ga0068868_100956981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales781Open in IMG/M
3300005356|Ga0070674_100114511All Organisms → cellular organisms → Bacteria → Proteobacteria1986Open in IMG/M
3300005546|Ga0070696_100536946All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300005549|Ga0070704_101241374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum681Open in IMG/M
3300005549|Ga0070704_102060571All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005713|Ga0066905_100942019Not Available758Open in IMG/M
3300005764|Ga0066903_100441365All Organisms → cellular organisms → Bacteria2169Open in IMG/M
3300005764|Ga0066903_101025520All Organisms → cellular organisms → Bacteria → Proteobacteria1511Open in IMG/M
3300005764|Ga0066903_101541498All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300006794|Ga0066658_10640965All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300006852|Ga0075433_10018247All Organisms → cellular organisms → Bacteria5828Open in IMG/M
3300006852|Ga0075433_10364401All Organisms → cellular organisms → Bacteria → Proteobacteria1276Open in IMG/M
3300006871|Ga0075434_100012997All Organisms → cellular organisms → Bacteria → Proteobacteria7906Open in IMG/M
3300006881|Ga0068865_102064843All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006894|Ga0079215_11244546All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300007076|Ga0075435_100749939All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300009012|Ga0066710_100730632All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300009038|Ga0099829_10587170All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300009100|Ga0075418_10184087All Organisms → cellular organisms → Bacteria2224Open in IMG/M
3300009137|Ga0066709_100024249All Organisms → cellular organisms → Bacteria6225Open in IMG/M
3300009137|Ga0066709_100073788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4025Open in IMG/M
3300009143|Ga0099792_11166717Not Available521Open in IMG/M
3300009147|Ga0114129_10017489All Organisms → cellular organisms → Bacteria → Proteobacteria10209Open in IMG/M
3300009147|Ga0114129_11323668All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300009156|Ga0111538_10313897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1984Open in IMG/M
3300009156|Ga0111538_13156623All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009162|Ga0075423_10797239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → unclassified Caulobacteraceae → Caulobacteraceae bacterium999Open in IMG/M
3300009176|Ga0105242_10040274All Organisms → cellular organisms → Bacteria3765Open in IMG/M
3300009176|Ga0105242_11800390All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009177|Ga0105248_13200773All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300009610|Ga0105340_1184936Not Available872Open in IMG/M
3300010043|Ga0126380_11708047All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300010043|Ga0126380_12069150All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010046|Ga0126384_11449167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300010047|Ga0126382_11452877All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300010358|Ga0126370_10216827All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300010360|Ga0126372_10337855All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300010362|Ga0126377_10154191All Organisms → cellular organisms → Bacteria → Proteobacteria2161Open in IMG/M
3300010362|Ga0126377_10331880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1511Open in IMG/M
3300010362|Ga0126377_12286157All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010366|Ga0126379_13240660All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300011440|Ga0137433_1045937All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.1292Open in IMG/M
3300012685|Ga0137397_10568882All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012685|Ga0137397_10783057All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300012918|Ga0137396_10005902All Organisms → cellular organisms → Bacteria7164Open in IMG/M
3300012948|Ga0126375_11484915All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012948|Ga0126375_12111302Not Available501Open in IMG/M
3300012958|Ga0164299_10735247All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300012960|Ga0164301_11352557All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012971|Ga0126369_12614937All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012986|Ga0164304_10808939All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300012989|Ga0164305_11892569All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300013297|Ga0157378_10658340Not Available1063Open in IMG/M
3300013308|Ga0157375_11906268All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300014326|Ga0157380_10847867All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300015357|Ga0134072_10116179All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300015371|Ga0132258_10748330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2462Open in IMG/M
3300015371|Ga0132258_13170062All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300015374|Ga0132255_105152691All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300016371|Ga0182034_11521330Not Available586Open in IMG/M
3300018067|Ga0184611_1252223All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300018073|Ga0184624_10271865Not Available760Open in IMG/M
3300018083|Ga0184628_10009579All Organisms → cellular organisms → Bacteria → Acidobacteria4677Open in IMG/M
3300018084|Ga0184629_10470702All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300018433|Ga0066667_10428985All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300018433|Ga0066667_10468290All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300018433|Ga0066667_10486642All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300018481|Ga0190271_12664679All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021339|Ga0193706_1146525All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300021560|Ga0126371_10934026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1011Open in IMG/M
3300025906|Ga0207699_11321657All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300025936|Ga0207670_10904469All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300026088|Ga0207641_10810889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300026310|Ga0209239_1073851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1485Open in IMG/M
3300027273|Ga0209886_1050259All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300027821|Ga0209811_10223440All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300027835|Ga0209515_10014347All Organisms → cellular organisms → Bacteria → Acidobacteria8207Open in IMG/M
3300027846|Ga0209180_10699432Not Available551Open in IMG/M
3300027907|Ga0207428_10557545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium828Open in IMG/M
3300028536|Ga0137415_10043537All Organisms → cellular organisms → Bacteria → Proteobacteria4381Open in IMG/M
3300028536|Ga0137415_11391232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300030989|Ga0308196_1024801Not Available724Open in IMG/M
3300031226|Ga0307497_10235854All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031226|Ga0307497_10328360All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300031231|Ga0170824_128477032Not Available544Open in IMG/M
3300031716|Ga0310813_12331102Not Available507Open in IMG/M
3300031720|Ga0307469_10421354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1147Open in IMG/M
3300031720|Ga0307469_11390385All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031740|Ga0307468_102041165Not Available550Open in IMG/M
3300031795|Ga0318557_10058302All Organisms → cellular organisms → Bacteria → Acidobacteria1641Open in IMG/M
3300032000|Ga0310903_10834943All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300032059|Ga0318533_10975063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300032180|Ga0307471_100148829Not Available2247Open in IMG/M
3300032180|Ga0307471_102236025All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300032180|Ga0307471_102549962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300032770|Ga0335085_10535688Not Available1330Open in IMG/M
3300033412|Ga0310810_10433160All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300033433|Ga0326726_11502799All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300033475|Ga0310811_10959264All Organisms → cellular organisms → Bacteria758Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.32%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1036670323300000363SoilVIDPAALQMVLGVLIGWLDRRERDAIAYLIEENQLLRNQELGTKRLRFTDDDR
Ga0063356_10490455923300004463Arabidopsis Thaliana RhizosphereVVDASAFQFLLMIVTGWLARREREVIAYLIEENRCLRRQLGTRRVRLTDD
Ga0062594_10048253723300005093SoilVIDFAALQMVLGVLTGWLDRREREAIAYLVEENRLLRRQLGGR
Ga0066388_10197311323300005332Tropical Forest SoilLDAAALQWLLLVLTSWLERREREIVAYLVVENRLLRRQLGTRRMRLTDR*
Ga0068868_10095698113300005338Miscanthus RhizosphereVIDPAALQMVLCVLTGWPERREREAIAYLIEENRLLRRQLGTRRLRLT
Ga0070674_10011451143300005356Miscanthus RhizosphereVIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA*
Ga0070696_10053694613300005546Corn, Switchgrass And Miscanthus RhizosphereVFDAAALQWLLLVLTSWLERREREVVAYLIVENRLLRRQSGRDGYG*
Ga0070704_10124137413300005549Corn, Switchgrass And Miscanthus RhizosphereVIDLSALQMLLMVVTGWLDRREREVLAYPIEENRLLRRQVGGRRLHLTDDDRRRLAV
Ga0070704_10206057113300005549Corn, Switchgrass And Miscanthus RhizosphereVIDVVVVHMVLGALTGWLERRERQAIAYLIEENRLLRRQLGRRRLRLTD
Ga0066905_10094201923300005713Tropical Forest SoilVIDVSALQLLLTILTGWLKSQEREVIGYLVAENRCLRRQ
Ga0066903_10044136523300005764Tropical Forest SoilVIGPAALQMVLCVLIGYLHRREREAVAHMIEENWLRRRQLGARRLRLNDNAHRHG*
Ga0066903_10102552023300005764Tropical Forest SoilVIDLSALQLLLMVLTDWLERREREAIAYLIEENRVRCV*
Ga0066903_10154149823300005764Tropical Forest SoilVIDVSALQLLLLAVTGWLDRRERDAMAYLIEENRILRRQIGG
Ga0066903_10306172713300005764Tropical Forest SoilVICTPAVIDAPALQLLLAVLTGWLNRQERATIGYLIAENRLLRR
Ga0066658_1064096513300006794SoilVIDPAALQMVLGVLTGWLERQEREGIAYLIEENRLLRRQL
Ga0075433_1001824713300006852Populus RhizosphereVIDPAALQIVLAVLTGWLERREREAIAYLIEENRLLRRQLG
Ga0075433_1036440113300006852Populus RhizosphereMFHMLLPGVTGWQDRREREVLAYLMEENRVLRRQVGGRRL
Ga0075434_10001299733300006871Populus RhizosphereVFDAPALQWLLPVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS*
Ga0068865_10206484313300006881Miscanthus RhizosphereVIDPAALQMVLCVLNGWLDRREREAVAYLIEENRCLRR*
Ga0079215_1124454613300006894Agricultural SoilVIDPAALQMVLGVLTGWLERRERETIAYLSEENRL
Ga0075435_10074993913300007076Populus RhizosphereVITPAALKMWLLVLTGWLERRERDALAYLIEENRLLRRQLGARR
Ga0066710_10073063223300009012Grasslands SoilMVSMVLTGWLERRERSALAYLIEENRLLRRQLGGRRVR
Ga0099829_1058717023300009038Vadose Zone SoilMLPLVIAPAALQMLLLVLTGWLERREQEAIAYLIEENRLLRR
Ga0075418_1018408723300009100Populus RhizosphereVFDAPARQWLLPVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS*
Ga0066709_10002424933300009137Grasslands SoilVIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRR*
Ga0066709_10007378813300009137Grasslands SoilVIDMSALQMWFAVLIGWLDRQEREALAYLIEENRVL
Ga0099792_1116671713300009143Vadose Zone SoilVIDPAALQMVPGVLTGWLARREREAIAYVIEENLLLRRQLGTRR
Ga0114129_1001748953300009147Populus RhizosphereVFDAPARQWLLLVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS*
Ga0114129_1132366813300009147Populus RhizosphereMLRLVIDVTTLQLVLSVLIAWLDCREREAVAYLIEENRLLRR*
Ga0111538_1031389743300009156Populus RhizosphereVIDVSSLQMLLLTVTSWLGHREREVLAYLIEENRI
Ga0111538_1315662323300009156Populus RhizosphereVIDASAFQLLLMVVTGWLARREREVIAYLIEENRCLRRQLGSRRVRLT*
Ga0075423_1079723913300009162Populus RhizosphereKRPLVFDAPARQWLLLVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS*
Ga0105242_1004027433300009176Miscanthus RhizosphereVIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRKLGAGGC
Ga0105242_1180039013300009176Miscanthus RhizosphereVINAALQMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA*
Ga0105248_1320077313300009177Switchgrass RhizosphereVIRRVLQMVVSVLTDWLERREWKAIAYVVEENRLLRR*
Ga0105340_118493623300009610SoilMLRLVIDLAALQTMLGVLTGWLGRRERDAVAYLVEENRLMRRELGGCRLRLP
Ga0126380_1170804723300010043Tropical Forest SoilVIDLSAVQMLLMVLTGLLDRRDREALRYLIEENRL
Ga0126380_1206915023300010043Tropical Forest SoilVIDVSVLQVLLLAVTGWLDRREREVIAYLMEENRLLRRQI
Ga0126384_1144916723300010046Tropical Forest SoilMSAVTDVSALQMVLAVLTGWLDRQEREALRYLIEENRVLRRQLG
Ga0126382_1145287723300010047Tropical Forest SoilMTRAVIDVSSFRLLLFILTGWLDRRERDALAYLMEENRLLRR
Ga0126370_1021682723300010358Tropical Forest SoilVIDPSGLQMVMVVLTGWLDRREREAVAFLIEENRSCGAN*
Ga0126372_1033785523300010360Tropical Forest SoilVINVAALQMVLGVLTGWLERAEREAIAYVVEENRLLRR*
Ga0126377_1015419133300010362Tropical Forest SoilVIDPSVLRLVLLILTGWLERREREVIAYLVEENRCLRRQLGKPAATPD*
Ga0126377_1033188013300010362Tropical Forest SoilKLPLVFDAATLQWLLLVLTSWLEHREREVIAYLVIENRLLRRQLGTP*
Ga0126377_1228615713300010362Tropical Forest SoilVFDAAALPWVLLVLTSWLERREREVLAYLIAENRLLRRQLGRNARG*
Ga0126379_1324066013300010366Tropical Forest SoilMLHLLLLAVTGWLDRRERAAMAHLIEENHLLRRQI
Ga0134121_1004112713300010401Terrestrial SoilVFDAAALQWLFLVLTSWLERRERDTLAYLIAENRLLRGQL
Ga0137433_104593713300011440SoilVFDTVPLHRLLLVLTGWLECRERDAVMYLIAENRLIRRQLGTRRLRLTDADR
Ga0137397_1056888223300012685Vadose Zone SoilVIDPAALQMVLGVLTGWLERREREAIAYPIEENRLLRRQLGTRRLRLTD
Ga0137397_1078305713300012685Vadose Zone SoilVIDPAALQIVLGVLTGWLERREREAIAYPIEENRLLR
Ga0137396_1000590223300012918Vadose Zone SoilVIEALALQLVLAVLTGWLDRREREVLRYLVEENRVLRRQLQGGVWS*
Ga0126375_1027960513300012948Tropical Forest SoilVPLVFDAAALQRVLLVLTSWLERREREILAYLIVENR
Ga0126375_1148491523300012948Tropical Forest SoilVINIAALQMVLGVLTGWLERREREAIAYLIEENRLLRRQLDGPRL
Ga0126375_1211130223300012948Tropical Forest SoilVFDAAALQWLLLVLTSWLERREREVVAYLIVENRLLRRQLGTRRMQLTDAD
Ga0164299_1073524713300012958SoilVIDPAALQMVLGVLTGWLDRREREAIALYLLRSPSK
Ga0164301_1135255723300012960SoilVIDPAALQMVLCVLTGRLDRREREAVAYLIEENRLLRRQLG
Ga0126369_1261493713300012971Tropical Forest SoilVIDLSALRLLLLTITGWLERRQREALAYLVEENDFET
Ga0164304_1080893923300012986SoilVIDAAALQMVLSVLIGWLERREREVIAYLIEENRLLRKDSTIG*
Ga0164305_1189256913300012989SoilVIDPAALQIVLCVLTGWLVRREREAVAYLIEENRLLRR
Ga0157378_1065834013300013297Miscanthus RhizosphereVFDAAALQWLLLVLTSWLEHREREVIAYLVIENRLLRRQLGTRRIRLMDGDRRRL
Ga0157375_1190626833300013308Miscanthus RhizosphereVIDLSALQLLLMVLTGWLDRREREAIAYLIEENRLPK
Ga0157380_1084786723300014326Switchgrass RhizosphereMVLGVLTGWLDRREREAVASLIEENRLLRRQLGTRRPRGNG
Ga0134072_1011617933300015357Grasslands SoilVIDVSVLRLLLLTITGWLDRREREALAYLIEENRLLRNMSVSVA
Ga0132258_1074833043300015371Arabidopsis RhizosphereVINIAALQMVLGVLTGWLERREREAIAYLIEENRF
Ga0132258_1317006233300015371Arabidopsis RhizosphereMIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA*
Ga0132255_10515269113300015374Arabidopsis RhizosphereVIDLAALQMMLGVLIGWLDRRERDAIAYLIEENRLLRRQLG
Ga0182034_1152133013300016371SoilVIDPAALQMVLIMLSGWLENRERHAVAYLIEENRLLR
Ga0184611_125222323300018067Groundwater SedimentVIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA
Ga0184624_1027186513300018073Groundwater SedimentMVLMVLTGWIKRRERHAVARLVEENRLLRRQLDRIA
Ga0184628_1000957963300018083Groundwater SedimentVIDLAALQMVLGVLTGWLERREREAVAYLIEENRLLRRQLGTRRL
Ga0184629_1047070223300018084Groundwater SedimentVIDASALQMVLAVLTGWLDRQERPALAYLMEELRARFGREEH
Ga0066667_1042898513300018433Grasslands SoilVPVLRLLLLTVIGWLDHREREALAYLIEENRLLRRQSGGRRLS
Ga0066667_1046829033300018433Grasslands SoilVIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRR
Ga0066667_1048664213300018433Grasslands SoilVIDMSALQMWFAVLIGWLDRQEREALAYLIEENRVLRAQLVGDACV
Ga0190271_1266467913300018481SoilVIDPATLQMVLGMLTGWLDRREREAIAYLIEENRLLRRQLGTTG
Ga0193706_114652513300021339SoilMVLAVLTGWLDRQERHAVAYLIEEIRVLRRRLGPKR
Ga0126371_1093402623300021560Tropical Forest SoilVIDPAALQMVLGMLTGWLERREREAIAYLVEENRLLRRQLGTRRL
Ga0207699_1132165733300025906Corn, Switchgrass And Miscanthus RhizosphereVIDPAALQIVLTVLTGWLDRREREAVAYLIEENRRVR
Ga0207670_1090446913300025936Switchgrass RhizosphereVIDPAALQMVLGVLTGWLDRREREAVAYLIEENRSL
Ga0207641_1081088913300026088Switchgrass RhizosphereVIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRKLGAGGCA
Ga0209239_107385123300026310Grasslands SoilVIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRRQIG
Ga0209886_105025913300027273Groundwater SandVIDPAALQMVLGVLTGWLDRREREAVAYLIEENRLLRRQLG
Ga0209811_1022344023300027821Surface SoilVIDFVALQMVLGVLTGWLDRREREAVAYLIEENPLLRRQLGERRLRRQH
Ga0209515_1001434793300027835GroundwaterVIDPAALQMVPGVLTGWLERREREVIAYLIEENRLLRRQLGRPGGCA
Ga0209180_1069943223300027846Vadose Zone SoilMLPLVIAPAALQMLLLVLTGWLERREQEAIAYLIEENRL
Ga0207428_1055754513300027907Populus RhizosphereMLLLTVTSWLGHQEREVLAYLIEENRILRRELGGRHLCL
Ga0137415_1004353743300028536Vadose Zone SoilVIEALALQLVLAVLTGWLDRREREVLRYLVEENRVLRRQLQGGVWS
Ga0137415_1139123213300028536Vadose Zone SoilVIDVAVVQMVLGALTDWLERRERQAIAYLIEENRLLRRHTASVGSAS
Ga0308196_102480133300030989SoilVFDAAALQWLLLVLTSWLERREREVLAYLVVENRLLRRQLGTRR
Ga0307497_1023585423300031226SoilMVLCVLTGWLDRREREAVAYLIEENRLLRRQLGTRR
Ga0307497_1032836013300031226SoilMVLGVLTGWLDRREREAVAYLIEENRLLRRQLGTGRP
Ga0170824_12847703223300031231Forest SoilVIDPAALRMVLGVLTGWLERRERETIAYLIEENPLSLLKT
Ga0310813_1233110223300031716SoilVIDLSALQLLLMVLTGWLERREREVIAYLIEENRLLKR
Ga0307469_1042135423300031720Hardwood Forest SoilVINIAVLQMVLGVLTGWLERREREAITYLVEENRLLRR
Ga0307469_1139038523300031720Hardwood Forest SoilVINIAALQMVLGVLTGWLERREREAIDYLVEENRLLRRQLGRRRIR
Ga0307468_10204116523300031740Hardwood Forest SoilVFDIAALRVLVLVVTGWLERRERDAIAYLIEENRLVECVN
Ga0318557_1005830213300031795SoilMVLGVLTGWLDRREREVVAYLIEENRLLRRQRGTRRL
Ga0310903_1083494313300032000SoilVIDLTTLRLVLSVLTGWLDCREREAIGYLIEENRLLRRQLCGRRLR
Ga0318533_1097506313300032059SoilVIDASALQMLLAVLTGWLNRRERDVISYLVAENRLLRRQLRPAPAAHG
Ga0307471_10014882933300032180Hardwood Forest SoilMIWLDSVIDPAALQMVLRVLTGWLERLEREAIAYVI
Ga0307471_10223602513300032180Hardwood Forest SoilVIDLSALQMLLLVVTGWLDRREREVLAYLIEENRLLRRQVGG
Ga0307471_10254996223300032180Hardwood Forest SoilVRDARDPVIDPAALQMALGMLTGWLERREREALAYLIEENRLLRRQLGTGGCS
Ga0335085_1053568823300032770SoilMVLGVLTGCLGRRERAAIAYLIEENRLLRRQLGTGRLRLTDDDADGWRR
Ga0310810_1043316033300033412SoilMIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA
Ga0326726_1150279913300033433Peat SoilVIDAAALQMVLFVLTGWLDRREREAVAYLIEENRLLRR
Ga0310811_1095926423300033475SoilVIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.