Basic Information | |
---|---|
Family ID | F093552 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 40 residues |
Representative Sequence | YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.77 % |
% of genes near scaffold ends (potentially truncated) | 91.51 % |
% of genes from short scaffolds (< 2000 bps) | 90.57 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.396 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.981 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.415 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.792 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF05157 | T2SSE_N | 8.49 |
PF05643 | DUF799 | 7.55 |
PF00496 | SBP_bac_5 | 4.72 |
PF02615 | Ldh_2 | 4.72 |
PF12697 | Abhydrolase_6 | 3.77 |
PF05378 | Hydant_A_N | 2.83 |
PF09948 | DUF2182 | 2.83 |
PF02604 | PhdYeFM_antitox | 1.89 |
PF13671 | AAA_33 | 1.89 |
PF04909 | Amidohydro_2 | 1.89 |
PF00501 | AMP-binding | 0.94 |
PF01555 | N6_N4_Mtase | 0.94 |
PF13432 | TPR_16 | 0.94 |
PF14257 | DUF4349 | 0.94 |
PF00571 | CBS | 0.94 |
PF13646 | HEAT_2 | 0.94 |
PF09084 | NMT1 | 0.94 |
PF01402 | RHH_1 | 0.94 |
PF03534 | SpvB | 0.94 |
PF13620 | CarboxypepD_reg | 0.94 |
PF13565 | HTH_32 | 0.94 |
PF14559 | TPR_19 | 0.94 |
PF08450 | SGL | 0.94 |
PF00589 | Phage_integrase | 0.94 |
PF00005 | ABC_tran | 0.94 |
PF01850 | PIN | 0.94 |
PF00528 | BPD_transp_1 | 0.94 |
PF03092 | BT1 | 0.94 |
PF00296 | Bac_luciferase | 0.94 |
PF13229 | Beta_helix | 0.94 |
PF08352 | oligo_HPY | 0.94 |
PF01553 | Acyltransferase | 0.94 |
PF00866 | Ring_hydroxyl_B | 0.94 |
PF03972 | MmgE_PrpD | 0.94 |
PF12838 | Fer4_7 | 0.94 |
PF01425 | Amidase | 0.94 |
PF05685 | Uma2 | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG4380 | Uncharacterized conserved protein, DUF799 domain | Function unknown [S] | 7.55 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 5.66 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 4.72 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.89 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.89 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.94 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.94 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.94 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.94 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.94 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.94 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.94 |
COG5517 | 3-phenylpropionate/cinnamic acid dioxygenase, small subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.40 % |
Unclassified | root | N/A | 5.66 % |
Polyangium | genus | Polyangium | 0.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100769682 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300000891|JGI10214J12806_11507570 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
3300000956|JGI10216J12902_118146145 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300002911|JGI25390J43892_10061174 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300004643|Ga0062591_102707423 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005172|Ga0066683_10029027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3171 | Open in IMG/M |
3300005330|Ga0070690_100291159 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300005353|Ga0070669_100143663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1842 | Open in IMG/M |
3300005445|Ga0070708_101780019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300005536|Ga0070697_101395380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
3300005552|Ga0066701_10607634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 665 | Open in IMG/M |
3300005553|Ga0066695_10873392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300005559|Ga0066700_11088503 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005568|Ga0066703_10170795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1312 | Open in IMG/M |
3300005617|Ga0068859_100886943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 977 | Open in IMG/M |
3300005617|Ga0068859_100931639 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005713|Ga0066905_101243872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300006797|Ga0066659_11901206 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300006845|Ga0075421_100851876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
3300006853|Ga0075420_100255220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
3300006871|Ga0075434_100069103 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
3300006904|Ga0075424_100888167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 951 | Open in IMG/M |
3300006914|Ga0075436_101273290 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300006969|Ga0075419_10492262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
3300009089|Ga0099828_10433552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
3300009089|Ga0099828_10497334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonatronaceae → Desulfonatronum → Desulfonatronum lacustre | 1099 | Open in IMG/M |
3300009100|Ga0075418_11276136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300009100|Ga0075418_12275578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 591 | Open in IMG/M |
3300009100|Ga0075418_12993025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300009147|Ga0114129_12394534 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300009147|Ga0114129_13210228 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009157|Ga0105092_10238294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1021 | Open in IMG/M |
3300009795|Ga0105059_1062804 | Not Available | 519 | Open in IMG/M |
3300009813|Ga0105057_1100691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300010046|Ga0126384_11660623 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300010046|Ga0126384_11982623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300010047|Ga0126382_10351699 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300010304|Ga0134088_10026188 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
3300010336|Ga0134071_10156320 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1111 | Open in IMG/M |
3300010337|Ga0134062_10519976 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300010337|Ga0134062_10692609 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010358|Ga0126370_11707440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300010362|Ga0126377_13590683 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010366|Ga0126379_12379803 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300010366|Ga0126379_13254861 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300010391|Ga0136847_11042702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
3300012180|Ga0153974_1174136 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012189|Ga0137388_10741972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300012203|Ga0137399_11649403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
3300012205|Ga0137362_10374282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1234 | Open in IMG/M |
3300012209|Ga0137379_10442275 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300012211|Ga0137377_11515366 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300012350|Ga0137372_10415573 | Not Available | 1016 | Open in IMG/M |
3300012351|Ga0137386_10887790 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300012355|Ga0137369_10327333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
3300012361|Ga0137360_10596563 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300012362|Ga0137361_11754687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
3300012486|Ga0157331_1039268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300012918|Ga0137396_11044346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300012918|Ga0137396_11235774 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012930|Ga0137407_10146949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2079 | Open in IMG/M |
3300012930|Ga0137407_12005060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300012944|Ga0137410_10041464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3251 | Open in IMG/M |
3300012971|Ga0126369_11810874 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012971|Ga0126369_13404310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | 521 | Open in IMG/M |
3300012976|Ga0134076_10222863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300014154|Ga0134075_10157833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 970 | Open in IMG/M |
3300014154|Ga0134075_10466194 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300014881|Ga0180094_1079677 | Not Available | 734 | Open in IMG/M |
3300017654|Ga0134069_1332923 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300018053|Ga0184626_10079241 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300018078|Ga0184612_10259595 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300018079|Ga0184627_10040292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2391 | Open in IMG/M |
3300018079|Ga0184627_10274230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 886 | Open in IMG/M |
3300018422|Ga0190265_10072917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3108 | Open in IMG/M |
3300018431|Ga0066655_10082191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1758 | Open in IMG/M |
3300018431|Ga0066655_10486710 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300020063|Ga0180118_1162294 | Not Available | 513 | Open in IMG/M |
3300021081|Ga0210379_10327366 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9 | 672 | Open in IMG/M |
3300021090|Ga0210377_10795040 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300025173|Ga0209824_10148731 | Not Available | 844 | Open in IMG/M |
3300025922|Ga0207646_10282767 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300026075|Ga0207708_10247091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1437 | Open in IMG/M |
3300026285|Ga0209438_1136608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
3300026301|Ga0209238_1111855 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300026324|Ga0209470_1027271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2980 | Open in IMG/M |
3300026326|Ga0209801_1032855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2445 | Open in IMG/M |
3300026530|Ga0209807_1116474 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300026540|Ga0209376_1366052 | Not Available | 542 | Open in IMG/M |
3300027903|Ga0209488_10867428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300027957|Ga0209857_1083848 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031720|Ga0307469_10398982 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300031720|Ga0307469_10401798 | Polyangium → Polyangium aurulentum | 1170 | Open in IMG/M |
3300031720|Ga0307469_11841305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300031720|Ga0307469_11848061 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300031768|Ga0318509_10095569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1596 | Open in IMG/M |
3300031820|Ga0307473_10117691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
3300031859|Ga0318527_10158320 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300031949|Ga0214473_11461548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
3300032001|Ga0306922_11538391 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300032005|Ga0307411_10703915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
3300032075|Ga0310890_10039482 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
3300032180|Ga0307471_100834547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
3300032180|Ga0307471_101498260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
3300032205|Ga0307472_100612448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
3300034668|Ga0314793_021782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales | 1010 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.38% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.83% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.94% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.94% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1007696821 | 3300000364 | Soil | LAFIWGVGPTVEEPGINLIRSFAYSAPLEDLKLKKP* |
JGI10214J12806_115075702 | 3300000891 | Soil | IYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLKLKRP* |
JGI10216J12902_1181461451 | 3300000956 | Soil | YELAFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP* |
JGI25390J43892_100611742 | 3300002911 | Grasslands Soil | RPSSTRVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP* |
Ga0062591_1027074232 | 3300004643 | Soil | PLYELAFIWGVGPTVEEPGINLVRSFAYSAPLEDIKLKKP* |
Ga0066683_100290276 | 3300005172 | Soil | VTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP* |
Ga0070690_1002911593 | 3300005330 | Switchgrass Rhizosphere | THIPIYELAFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP* |
Ga0070669_1001436631 | 3300005353 | Switchgrass Rhizosphere | YVPIYELAFIWGVGPTVEEPGINLIRSFAYSAPLEDLKLKKP* |
Ga0070708_1017800192 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IPIYELAFIWGVSPRVEEPGVNLIRSFAYSGPLEDLRVKK* |
Ga0070697_1013953801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RVTHIPIYELAFIWGVHPRVEEPGVNLIRSFAYSGPVEDVRLKRQ* |
Ga0066701_106076341 | 3300005552 | Soil | LAFIWGVGPRVEEPGVNLIKSFAYSAPLEDLRLKRP* |
Ga0066695_108733921 | 3300005553 | Soil | YELAFIWGVGPRVEESGAWLIPGYAYSAPAEDLKLKK* |
Ga0066700_110885031 | 3300005559 | Soil | FIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP* |
Ga0066703_101707951 | 3300005568 | Soil | HIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP* |
Ga0068859_1008869431 | 3300005617 | Switchgrass Rhizosphere | FTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKKP* |
Ga0068859_1009316392 | 3300005617 | Switchgrass Rhizosphere | AFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP* |
Ga0066905_1012438722 | 3300005713 | Tropical Forest Soil | LAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP* |
Ga0066659_119012061 | 3300006797 | Soil | AFIWGVNPRVEEPGINLIRSYSYSAPYEDLKLKRP* |
Ga0075421_1008518762 | 3300006845 | Populus Rhizosphere | FIWGVGPRVEESGANLIPGFAYSAPFEDLKLKKP* |
Ga0075420_1002552203 | 3300006853 | Populus Rhizosphere | HIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLKLKRP* |
Ga0075434_1000691034 | 3300006871 | Populus Rhizosphere | VPIYELAFIWGVGPSVAEPGINLIRSFAYSGPLEDVRLKGR* |
Ga0075424_1008881671 | 3300006904 | Populus Rhizosphere | YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP* |
Ga0075436_1012732902 | 3300006914 | Populus Rhizosphere | AFTWGIGPRLEEPGISLIKGYAYSAPYEDMKLKRP* |
Ga0075419_104922622 | 3300006969 | Populus Rhizosphere | PIYELAFIWGVGPSVDEPGINLIRSFAYSGPLEDVRLKRR* |
Ga0099828_104335522 | 3300009089 | Vadose Zone Soil | LHDRMIQIPIYELAFIWGVSPRVDEPGINLIRSFAYSGPLEDVKIKRP* |
Ga0099828_104973341 | 3300009089 | Vadose Zone Soil | FIWGVGPRVEEPGVNLIKSFAYSAPLEDLRLKRP* |
Ga0075418_112761362 | 3300009100 | Populus Rhizosphere | YDRVTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLKLKRP* |
Ga0075418_122755782 | 3300009100 | Populus Rhizosphere | AFTWGIGPRLEEPGISLIRGYAYSAPYEDLRLKKP* |
Ga0075418_129930252 | 3300009100 | Populus Rhizosphere | LYDRVMYVPIYELAFIWGVGPTVDEPGINLIRSFAYSGPLEDVKLKKP* |
Ga0114129_123945342 | 3300009147 | Populus Rhizosphere | VTHIPIYELGLIWGVGPRVEEPGINLVRSFAYSAPLEDVKLNRP* |
Ga0114129_132102282 | 3300009147 | Populus Rhizosphere | VIQIPIYELAFIWGVGPRVEEPGISLIRSFASSGPLEDVRIKRP* |
Ga0105092_102382943 | 3300009157 | Freshwater Sediment | IYELAFIWGVGPRLEEPGINLIRSFAYSGPLEDLRLKRP* |
Ga0105059_10628042 | 3300009795 | Groundwater Sand | YDRMTHIPIYELAFIWSVGPRVQEPGINLVRSFAYSAPLEDVRLKRP* |
Ga0105057_11006911 | 3300009813 | Groundwater Sand | ELGFIWGVGPRVEDPGVNLIRAFAYSGPLEDVKLKRP* |
Ga0126384_116606231 | 3300010046 | Tropical Forest Soil | FIWGVGPRAEEPGVNLIRSFAYSGPLEDLRLKRP* |
Ga0126384_119826232 | 3300010046 | Tropical Forest Soil | VTHIPIYELAFIWGVGPRAEEPGINLIRSFAYSGPLEDLRIKK* |
Ga0126382_103516991 | 3300010047 | Tropical Forest Soil | LYELAFIWGVSPRVEEPGINLIRSFAYSAPLEEVRFKRP* |
Ga0134088_100261883 | 3300010304 | Grasslands Soil | FTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP* |
Ga0134071_101563201 | 3300010336 | Grasslands Soil | SAFLWAIGPRVEEPGLSLIPSHAYSAPYEDVKLKRP* |
Ga0134062_105199761 | 3300010337 | Grasslands Soil | LAFIWGVGPRVEEPGINLIRSFAYSGPLEDVKVKRP* |
Ga0134062_106926091 | 3300010337 | Grasslands Soil | VTHIPIYELAFIWGVGPRVEEPGINQLRSFSYSGPLEDLRVKRP* |
Ga0126370_117074402 | 3300010358 | Tropical Forest Soil | IYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRIKK* |
Ga0126377_135906832 | 3300010362 | Tropical Forest Soil | FTWGVSPRVEEPGINLIRSYAYSAPYEDLRLKHP* |
Ga0126379_123798032 | 3300010366 | Tropical Forest Soil | FIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP* |
Ga0126379_132548612 | 3300010366 | Tropical Forest Soil | IQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVRIKRP* |
Ga0136847_110427022 | 3300010391 | Freshwater Sediment | AFIWGVGPRVEEAGAGLIPGFAYSAPFEDLKVRK* |
Ga0153974_11741361 | 3300012180 | Attine Ant Fungus Gardens | LAFIWGVSPRVEEPGINLIRSHAYSAPYEDLRLKRP* |
Ga0137388_107419723 | 3300012189 | Vadose Zone Soil | LAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKQP* |
Ga0137399_116494032 | 3300012203 | Vadose Zone Soil | LAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKKP* |
Ga0137362_103742821 | 3300012205 | Vadose Zone Soil | MIQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVKIKRP* |
Ga0137379_104422754 | 3300012209 | Vadose Zone Soil | YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDVRVKRP* |
Ga0137377_115153661 | 3300012211 | Vadose Zone Soil | DHPPRGVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP* |
Ga0137372_104155731 | 3300012350 | Vadose Zone Soil | ELAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKRP* |
Ga0137386_108877902 | 3300012351 | Vadose Zone Soil | LAFIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP* |
Ga0137369_103273332 | 3300012355 | Vadose Zone Soil | VTHIPIYELAFIWGVGPTVDESGINLIRSFAYSGPLEDLRLKRP* |
Ga0137360_105965631 | 3300012361 | Vadose Zone Soil | IYDLAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP* |
Ga0137361_117546872 | 3300012362 | Vadose Zone Soil | LHDRMIQIPIYELAFIWGVNPRVEEPGINLIRSFAYSGPLEDVKIKRP* |
Ga0157331_10392682 | 3300012486 | Soil | MHVPIYELAFTWGIGPRVEEPGINIIKGFAYSGPLEDLKLKKQ* |
Ga0137396_110443462 | 3300012918 | Vadose Zone Soil | LAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRLKRP* |
Ga0137396_112357742 | 3300012918 | Vadose Zone Soil | YELAFIWGVGPSVDEPGVNLIRSYAYSAPLEDLRLKRP* |
Ga0137407_101469493 | 3300012930 | Vadose Zone Soil | IPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDVRLKRP* |
Ga0137407_120050602 | 3300012930 | Vadose Zone Soil | AFIWGVGPRVQEPCAGLIAGFPYSAPLEDVTLKK* |
Ga0137410_100414644 | 3300012944 | Vadose Zone Soil | RVTHVPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEELRLKRR* |
Ga0126369_118108741 | 3300012971 | Tropical Forest Soil | HDRMIQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVKIKRP* |
Ga0126369_134043103 | 3300012971 | Tropical Forest Soil | YELAFIWGVSPRVEEPGINLIRSYSYSAPYEDLRLKRP* |
Ga0134076_102228632 | 3300012976 | Grasslands Soil | THIPIYELAFIWGVGPRVEEPGINLNRSFAYSGPLEDVRVKRP* |
Ga0134075_101578331 | 3300014154 | Grasslands Soil | LAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP* |
Ga0134075_104661941 | 3300014154 | Grasslands Soil | GVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP* |
Ga0180094_10796771 | 3300014881 | Soil | MTIWGVGPRVEESGANLIPGFAYSAPFEDLQLRK* |
Ga0134069_13329231 | 3300017654 | Grasslands Soil | IYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR |
Ga0184626_100792413 | 3300018053 | Groundwater Sediment | YDRVTHIPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDLRLKRP |
Ga0184612_102595951 | 3300018078 | Groundwater Sediment | HIPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDLRLKRP |
Ga0184627_100402925 | 3300018079 | Groundwater Sediment | VTQIPIYELAFIWGVGSRVEEPGVNLVRSFAYSAPLEDLRLKRP |
Ga0184627_102742302 | 3300018079 | Groundwater Sediment | LAFIWGVGPRVEEPGVNLIRSYAYSGPLEDLRLKRP |
Ga0190265_100729173 | 3300018422 | Soil | VTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKKP |
Ga0066655_100821913 | 3300018431 | Grasslands Soil | ELAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP |
Ga0066655_104867102 | 3300018431 | Grasslands Soil | VTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP |
Ga0180118_11622941 | 3300020063 | Groundwater Sediment | IYELAFIWGVSPRVEEPGVNLIRSFAYSAPLEDLRLKRP |
Ga0210379_103273662 | 3300021081 | Groundwater Sediment | AFIWGVGPRVDEPGINLVRSFAYSAPLEDLRLKRP |
Ga0210377_107950402 | 3300021090 | Groundwater Sediment | THIPIYELAFIWGVGPTVDEPGVNLIRSFAYSAPLEDLRLKRP |
Ga0209824_101487312 | 3300025173 | Wastewater | MERAVLTHIPLYELAFIWGVGPGVEEPGINLIRSFAYSGPLEDVKLKRP |
Ga0207646_102827673 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP |
Ga0207708_102470911 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRIKK |
Ga0209438_11366082 | 3300026285 | Grasslands Soil | ELAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRIKK |
Ga0209238_11118552 | 3300026301 | Grasslands Soil | VTHIPIYELAFIWGVGPRVEEPGINQILSFSYSGPLEDLRVKRP |
Ga0209470_10272711 | 3300026324 | Soil | LGFIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP |
Ga0209801_10328551 | 3300026326 | Soil | PDHPPRGVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP |
Ga0209807_11164742 | 3300026530 | Soil | ELGFIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP |
Ga0209376_13660521 | 3300026540 | Soil | AFIWGVGPRVDEPGINLVRSFAYSAPLEDMKLKRP |
Ga0209488_108674282 | 3300027903 | Vadose Zone Soil | LAFIWGVGPRVEEPGINLIRSFAYSGPLEDVRIKRP |
Ga0209857_10838481 | 3300027957 | Groundwater Sand | YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDVKLKRP |
Ga0307469_103989821 | 3300031720 | Hardwood Forest Soil | LAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKKP |
Ga0307469_104017981 | 3300031720 | Hardwood Forest Soil | PIYELAFIWGVGPSVEEPGINLVRSFAYSAPLEDIKLKKP |
Ga0307469_118413052 | 3300031720 | Hardwood Forest Soil | IYELAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP |
Ga0307469_118480613 | 3300031720 | Hardwood Forest Soil | ELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR |
Ga0318509_100955691 | 3300031768 | Soil | AFIWGVGPRVEEPGINLIRSFAYSGPLEDVRIKRP |
Ga0307473_101176913 | 3300031820 | Hardwood Forest Soil | THIPIYELAFIWGVGSRVEEPGINLVRSFAYSAPLEDVKLKRP |
Ga0318527_101583201 | 3300031859 | Soil | SFIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP |
Ga0214473_114615481 | 3300031949 | Soil | RVTQIPIYELGFIWGVGPRAEEPGINLIRSYAYSAPLEDLKLKKP |
Ga0306922_115383911 | 3300032001 | Soil | YENAFIWGVGPRVEEPGINLVRGYAYSAPYEELRLRRP |
Ga0307411_107039152 | 3300032005 | Rhizosphere | RVTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKKP |
Ga0310890_100394821 | 3300032075 | Soil | IPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKRP |
Ga0307471_1008345472 | 3300032180 | Hardwood Forest Soil | PIYELAFIWGVGPSVEEPGINLIRSFAYSAPLEDLKLKKP |
Ga0307471_1014982601 | 3300032180 | Hardwood Forest Soil | VPIYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR |
Ga0307472_1006124481 | 3300032205 | Hardwood Forest Soil | VTHVPIYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR |
Ga0314793_021782_570_704 | 3300034668 | Soil | VTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKRP |
⦗Top⦘ |