NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093480

Metagenome Family F093480

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093480
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 43 residues
Representative Sequence MVIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDS
Number of Associated Samples 80
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.89 %
% of genes near scaffold ends (potentially truncated) 17.92 %
% of genes from short scaffolds (< 2000 bps) 80.19 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.868 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil
(13.207 % of family members)
Environment Ontology (ENVO) Unclassified
(27.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.208 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF12680SnoaL_2 22.64
PF07726AAA_3 16.98
PF10604Polyketide_cyc2 16.04
PF00581Rhodanese 14.15
PF07883Cupin_2 1.89
PF06963FPN1 0.94
PF00106adh_short 0.94
PF00486Trans_reg_C 0.94
PF12697Abhydrolase_6 0.94
PF03982DAGAT 0.94
PF00353HemolysinCabind 0.94
PF01841Transglut_core 0.94
PF01553Acyltransferase 0.94
PF13473Cupredoxin_1 0.94
PF01510Amidase_2 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.87 %
UnclassifiedrootN/A31.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01DSZRZNot Available506Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101560367Not Available658Open in IMG/M
3300000956|JGI10216J12902_100518081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3607Open in IMG/M
3300000956|JGI10216J12902_105255138Not Available1021Open in IMG/M
3300001686|C688J18823_10068099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2469Open in IMG/M
3300001686|C688J18823_10261795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300002568|C688J35102_118252188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia542Open in IMG/M
3300002568|C688J35102_120632689All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300002568|C688J35102_120908413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2214Open in IMG/M
3300003990|Ga0055455_10004236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2795Open in IMG/M
3300003990|Ga0055455_10014831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1820Open in IMG/M
3300004006|Ga0055453_10097626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales862Open in IMG/M
3300004081|Ga0063454_100007335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2706Open in IMG/M
3300004081|Ga0063454_100038274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1777Open in IMG/M
3300004081|Ga0063454_100082392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1452Open in IMG/M
3300004081|Ga0063454_101911654Not Available522Open in IMG/M
3300004114|Ga0062593_100267012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300004114|Ga0062593_101309587Not Available768Open in IMG/M
3300004153|Ga0063455_101406114Not Available538Open in IMG/M
3300004156|Ga0062589_100781418Not Available861Open in IMG/M
3300004156|Ga0062589_100944137All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300004479|Ga0062595_100245504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1156Open in IMG/M
3300004479|Ga0062595_100544079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales887Open in IMG/M
3300005332|Ga0066388_101315904Not Available1247Open in IMG/M
3300005332|Ga0066388_101999518Not Available1039Open in IMG/M
3300005332|Ga0066388_102848480Not Available884Open in IMG/M
3300005445|Ga0070708_101239815Not Available697Open in IMG/M
3300005456|Ga0070678_100382346Not Available1218Open in IMG/M
3300005468|Ga0070707_101372023Not Available673Open in IMG/M
3300005529|Ga0070741_10034731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6800Open in IMG/M
3300005578|Ga0068854_101857653All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005587|Ga0066654_10750889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales550Open in IMG/M
3300005614|Ga0068856_102403405All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005713|Ga0066905_100046773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales2615Open in IMG/M
3300005713|Ga0066905_100156787All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300005764|Ga0066903_101937402Not Available1130Open in IMG/M
3300005764|Ga0066903_107145464All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300005937|Ga0081455_10115982All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300005937|Ga0081455_10632789Not Available692Open in IMG/M
3300005981|Ga0081538_10157731All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005983|Ga0081540_1001193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales22751Open in IMG/M
3300006046|Ga0066652_100343267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus1342Open in IMG/M
3300006046|Ga0066652_101715046All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006048|Ga0075363_100501360All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300006051|Ga0075364_10345522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300006806|Ga0079220_10152617All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300009789|Ga0126307_10000059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria59397Open in IMG/M
3300009789|Ga0126307_10035935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3830Open in IMG/M
3300009789|Ga0126307_10095268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2355Open in IMG/M
3300009840|Ga0126313_10667513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300009840|Ga0126313_11316102Not Available597Open in IMG/M
3300009840|Ga0126313_11573573All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300010036|Ga0126305_11140568Not Available537Open in IMG/M
3300010037|Ga0126304_10476980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium837Open in IMG/M
3300010039|Ga0126309_10009514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3942Open in IMG/M
3300010040|Ga0126308_10532915Not Available796Open in IMG/M
3300010040|Ga0126308_11110624All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300010042|Ga0126314_10188013Not Available1451Open in IMG/M
3300010044|Ga0126310_10126102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1595Open in IMG/M
3300010166|Ga0126306_10305509Not Available1226Open in IMG/M
3300010362|Ga0126377_10910425Not Available942Open in IMG/M
3300010362|Ga0126377_11885394Not Available673Open in IMG/M
3300010371|Ga0134125_10720345Not Available1099Open in IMG/M
3300012198|Ga0137364_10202300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300012204|Ga0137374_10446957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300012212|Ga0150985_103956401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300012358|Ga0137368_10342244All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300012360|Ga0137375_10391066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus1219Open in IMG/M
3300012469|Ga0150984_102115198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300012924|Ga0137413_10054622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2331Open in IMG/M
3300012951|Ga0164300_10063024All Organisms → cellular organisms → Bacteria → Terrabacteria group1512Open in IMG/M
3300012958|Ga0164299_10053598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1899Open in IMG/M
3300012986|Ga0164304_10631411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300015242|Ga0137412_10094427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2431Open in IMG/M
3300018051|Ga0184620_10343615Not Available506Open in IMG/M
3300018431|Ga0066655_10691203All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300020140|Ga0179590_1197209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium552Open in IMG/M
3300022756|Ga0222622_10168591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300024055|Ga0247794_10317849Not Available527Open in IMG/M
3300024288|Ga0179589_10084934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus1267Open in IMG/M
3300024288|Ga0179589_10140412All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300025552|Ga0210142_1000565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00828045Open in IMG/M
3300026075|Ga0207708_10816587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium803Open in IMG/M
3300026118|Ga0207675_100044612All Organisms → cellular organisms → Bacteria4143Open in IMG/M
3300026121|Ga0207683_11814504Not Available559Open in IMG/M
3300028592|Ga0247822_10130567Not Available1835Open in IMG/M
3300028707|Ga0307291_1078728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300028710|Ga0307322_10012475Not Available1895Open in IMG/M
3300028718|Ga0307307_10244880All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300028720|Ga0307317_10079638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1073Open in IMG/M
3300028720|Ga0307317_10302556Not Available540Open in IMG/M
3300028755|Ga0307316_10025150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1922Open in IMG/M
3300028755|Ga0307316_10360171All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028782|Ga0307306_10190567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia584Open in IMG/M
3300028793|Ga0307299_10017584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2552Open in IMG/M
3300028812|Ga0247825_11040821Not Available595Open in IMG/M
3300028828|Ga0307312_10192798All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300028872|Ga0307314_10049413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1052Open in IMG/M
3300030511|Ga0268241_10035837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1025Open in IMG/M
3300031740|Ga0307468_100031626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2531Open in IMG/M
3300031938|Ga0308175_102361181Not Available596Open in IMG/M
3300031996|Ga0308176_10296179All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300032174|Ga0307470_11277568All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300032205|Ga0307472_100032554Not Available3046Open in IMG/M
3300033433|Ga0326726_10063293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3255Open in IMG/M
3300033550|Ga0247829_10289427Not Available1328Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.21%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil13.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil9.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.72%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.89%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_101592302189573000Grass SoilHMTVFIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDS
INPhiseqgaiiFebDRAFT_10156036713300000364SoilMVSVGPLILPLAHAGHILIDGAIFGVPVGSVLLTIFALNKWGPRDQ*
JGI10216J12902_10051808143300000956SoilMILFAHAGHILADAAIFGVPVGSVVLTILALRRWGPRDE*
JGI10216J12902_10525513813300000956SoilEATRATCACLMDPTLVIPLAHAGHVLADAAIFGVPVGSVLLTIWALNRWGPRDE*
C688J18823_1006809933300001686SoilVIVPFAHAGHVIADAAIFGFPVAMVIGTILALRRWGPKDE*
C688J18823_1026179533300001686SoilMTIVIPLAHAGHILADAAIFGVPVGSVLLTIFALNRWGPKDQ
C688J35102_11825218813300002568SoilVIAEVVIPLAHAGHVLADAAIFGVPVGSILLTIWALNRWGPKDN*
C688J35102_12063268933300002568SoilMIAALVIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDN*
C688J35102_12090841343300002568SoilMTLFIPLAHAGHVLADAAIFGVPVGSVLLTIFALNRWGPKDR*
Ga0055455_1000423623300003990Natural And Restored WetlandsMPVCVIVPLAHAGHVLADAAIFGVPVGSVLLTIWALNRWGPRDR*
Ga0055455_1001483133300003990Natural And Restored WetlandsMTLVIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKEK*
Ga0055453_1009762623300004006Natural And Restored WetlandsMTIIPLAHAGHVLVDAAIFLVPVGSVLLTIFALNRWGPKDR*
Ga0063454_10000733553300004081SoilMTIVIPLAHAGHILADAAIFGVPVGSVLLTIFALNRWGPKDQ*
Ga0063454_10003827423300004081SoilVIVPLAHAGHILADTAIFAVPVGMLLLTIFALNHWGPRDPER*
Ga0063454_10008239233300004081SoilMNAPVLIPLAHAGHVLVDAGIFLVPVGSVVLTILALRRWGPHDQ*
Ga0063454_10191165413300004081SoilMSFLLLAHAGHVLADAAIFGVPVGSVVLTIWALNRWGPKDS*
Ga0062593_10026701233300004114SoilMDPTIAIPLAHAGHILADAAIFGVPVGSVLLTIWLLNRLGPKDG*
Ga0062593_10130958713300004114SoilVIIPLAVIIPLAHAGHVIADAAIFGVPVGSVLLTIWALNRWGPRDD*
Ga0063455_10140611423300004153SoilMSILIPLAHAGHVLADAAIFGVPVGSVLLTIYALNRWGPKDPES*
Ga0062589_10078141823300004156SoilMILLLAHAGHVLADAAIFGVPVGMVVGTILILRKWGPQDD*
Ga0062589_10094413723300004156SoilMTLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPRDE*
Ga0062595_10024550433300004479SoilVIILLEVIIPLAHAGHVLADAAIFGVPVGSVLLTIWALNRWGPRDD*
Ga0062595_10054407923300004479SoilMVSVGPLILPLAHAGHILIDGAIFLVPVGMVVGTILILRKWGPQDE*
Ga0066388_10131590423300005332Tropical Forest SoilVTFFLLAHAGHILADAAIFGVPVGSVVLTLWALNRWGPKDE*
Ga0066388_10199951833300005332Tropical Forest SoilMMEATIAIPLAHAGHILADAAIFGVPVGSVLLTIWLLNRWGPRDG*
Ga0066388_10284848023300005332Tropical Forest SoilMALLVPLAHAGHILADAAIFGVPVGSVLLAIWALNRMGPKDR*
Ga0070708_10123981523300005445Corn, Switchgrass And Miscanthus RhizosphereMALLVPLAHAGHILADAAIFGVPVGSVLLTIFALNRWGPRDN*
Ga0070678_10038234623300005456Miscanthus RhizosphereMPLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWGLNRWGPRDE*
Ga0070707_10137202323300005468Corn, Switchgrass And Miscanthus RhizosphereDLMALVEIPLAHAGHILADASIFRVPVGSVLLTIWALNRWGPRDG*
Ga0070741_1003473143300005529Surface SoilVSLLAEIAIPLAHAGHILADAAIFGVPVGMVVGTILILRKWGPRDE*
Ga0068854_10185765313300005578Corn RhizosphereMPLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWAL
Ga0066654_1075088923300005587SoilMPMGAVLLLAHAGHILADAAIFGVPVGSIVLTIFALSRWGPR*
Ga0068856_10240340523300005614Corn RhizosphereMTAELVIPLAHAGHILADAAIFGVPVGSVVLTIWGLNRWGPKDPDESEKSN*
Ga0066905_10004677343300005713Tropical Forest SoilMDPTPVIPLAHAGHVLADAAFFVVPVGSILLTIWALNRWGPKDN*
Ga0066905_10015678723300005713Tropical Forest SoilMTAVALAIPLAHAGHILADAAIFGVPVGSVLLTVWALNRWGPKDG*
Ga0066903_10193740223300005764Tropical Forest SoilMPIFIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDQ*
Ga0066903_10714546423300005764Tropical Forest SoilMIIPLAHAGHILADAAIFGVPVGSVLLTIWGLNRWGPKDPEDR*
Ga0081455_1011598233300005937Tabebuia Heterophylla RhizosphereMALLVPLAHAGHVLADAAIFGVPVGSVLLTIWALNRWGPKDQ*
Ga0081455_1063278923300005937Tabebuia Heterophylla RhizosphereMALAVLIPLAHAGHILADAAIFGVPVGSVVLTIWGLNKWGPKEPHDG*
Ga0081538_1015773113300005981Tabebuia Heterophylla RhizosphereMDLGALVPLAHAGHWLADAAFFVVPVGSILLTIFVLRRWGPKDE*
Ga0081540_1001193143300005983Tabebuia Heterophylla RhizosphereMSFELLIPLAHAGHILADAAIFGVPVGSVLLTIWALNHWGPKDG*
Ga0066652_10034326723300006046SoilMTPLAVIVPLAHAGHILADAAIFGVPVGSVVLTIWGLNRWGPKDE*
Ga0066652_10171504623300006046SoilMNFLFLAHAGHVLADAAIFGVPVGSVVLTIWALNRWGPKDS*
Ga0075363_10050136023300006048Populus EndosphereVTLFIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDQ*
Ga0075364_1034552213300006051Populus EndosphereAHAGHILADAAIFAIPVGSVLLTIFALNRWGPKDR*
Ga0079220_1015261733300006806Agricultural SoilMTFLLLAHAGHVLADAAIFGVPVGSVVLTIWALNRWGPKDE*
Ga0126307_10000059203300009789Serpentine SoilMVIPLAHAGHILADAAIFLVPVGSILLTIWALNRWGPKDS*
Ga0126307_1003593543300009789Serpentine SoilVTALGVIVPLAHAGHVLADAAIFVVPVGSVLLTIFALNRWGPRDR*
Ga0126307_1009526823300009789Serpentine SoilMDPGLAIPLAHAGHWLFNAAVFLVPVGSILLTIWALNRWGPKDN*
Ga0126313_1066751333300009840Serpentine SoilMIVPLAHAGHILADTAIFAAPVGSVLLTIFALNRWGPKDR
Ga0126313_1131610223300009840Serpentine SoilAHAGHVIADAAFFLVPVGSVVLTIVALRRWGPKDR*
Ga0126313_1157357323300009840Serpentine SoilVSFLLLAHAGHWLANAAFFLVPVGSVVFTIWALNRWGPKDE*
Ga0126305_1114056823300010036Serpentine SoilMIPLAHAGHVLADAAIFLVPVGSVVLTILALRRWGPGDR*
Ga0126304_1047698023300010037Serpentine SoilMDPDLAVPLAHAAHVIVDTAFFLVPVGSILLTIWALNRWGPKDN*
Ga0126309_1000951443300010039Serpentine SoilMTFLLLAHAGHVLADAAIFLVPVGSVVLTIFALNRWGPKDR*
Ga0126308_1053291523300010040Serpentine SoilMIPLAHAGHVLADAAIFLVPVGSVVLMILALRRWGPRDR*
Ga0126308_1111062423300010040Serpentine SoilVSFLLLAHAGHVIADAAFFLVPVGSVVLTIVALRRWGPKDR*
Ga0126314_1018801323300010042Serpentine SoilVSFLLLAHAGHVIADAAFFVVPVGSVVLTIVALRRWGPKDR*
Ga0126310_1012610223300010044Serpentine SoilVNFLVPLAHAGHVLADTAIFGVPVGSVLLTIWALNRWGPRDD*
Ga0126306_1030550913300010166Serpentine SoilTGHRLMDPDLAVPLAHAAHVIVDTAFFLVPVGSILLTIFVLRHGPKDN*
Ga0126377_1091042523300010362Tropical Forest SoilMDPTLVIPLAHAGHILADAAIFGVPVGSVLLTIWGLNKWGPKDDGEEPKAR*
Ga0126377_1188539423300010362Tropical Forest SoilMDPTPVIPLAHAGHVLADAAFFVVPVGSILLTIWALNRWGPKDE*
Ga0134125_1072034533300010371Terrestrial SoilMPLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPRDE*
Ga0137364_1020230033300012198Vadose Zone SoilMMIPLAHAGHILADAGIFLVPVGSVVLTILALNRWGPR*
Ga0137374_1044695733300012204Vadose Zone SoilMMPLAHAGHVLADAAIFLIPVGSVLLTILALNRRGTKDR*
Ga0150985_10395640123300012212Avena Fatua RhizosphereVTIFIPLAHAGHVLADAAIFLVPVGSVLLTIFALNRWGPKDR*
Ga0137368_1034224423300012358Vadose Zone SoilMMPLAHAGHVLADAAIFLIPVGSVLLTILALNGWGTKDR*
Ga0137375_1039106623300012360Vadose Zone SoilMMPLAHAGHVLADAAIFLIPVGSVLLTILALNRWGTKDR*
Ga0150984_10211519833300012469Avena Fatua RhizosphereVIVPLAHAGHVIADAAIFGFPLVMVIGTILALRRWGPKDE*
Ga0137413_1005462213300012924Vadose Zone SoilQGSRGGRRLMSPFILAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDR*
Ga0164300_1006302443300012951SoilVIAELVIPLAHAGHVLADAAIFGVPVGSILLTIWALNRWGPKDN*
Ga0164299_1005359843300012958SoilVIAELVIPLAHAGHVLADAAIFGVPVGSSLLTIWALNRWGPKDN*
Ga0164304_1063141123300012986SoilVTALGLVLVLAHAGHVIADAAIFGVPVGMVVGTILILRKWGPQDE*
Ga0137412_1009442743300015242Vadose Zone SoilMSPFILAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDR*
Ga0184620_1034361523300018051Groundwater SedimentMDPTLVIPLAHAGHILADAAIFGVPVGSVLLTIWGLNHWGPKDE
Ga0066655_1069120323300018431Grasslands SoilVTPIALVLILAHAGHILADAAIYGVPVGMVVGTIFILRKWGPRDE
Ga0179590_119720923300020140Vadose Zone SoilMIVPLAHAGHVLVDAAIFLVPVGSVLLTIFALNRWGPSDD
Ga0222622_1016859133300022756Groundwater SedimentMIAEIVIPLAHAGHILADAAIFGVPVGSILLTIWALNRWGPKDS
Ga0247794_1031784923300024055SoilAHAGHVIADAAIFGVPVGSVLLTIWALNRWGPRDD
Ga0179589_1008493423300024288Vadose Zone SoilMILPLAHAGHILADAAIFGVPVGSVLLTIFALNRWGPKDQ
Ga0179589_1014041223300024288Vadose Zone SoilMSPFILAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDR
Ga0210142_100056543300025552Natural And Restored WetlandsMPVCVIVPLAHAGHVLADAAIFGVPVGSVLLTIWALNRWGPRDR
Ga0207708_1081658723300026075Corn, Switchgrass And Miscanthus RhizosphereMPLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPRDE
Ga0207675_10004461213300026118Switchgrass RhizosphereARVIPLAAQVIIPLAHAGHILADAAIFGVPVGSVALTIFILNKWGPKDG
Ga0207683_1181450423300026121Miscanthus RhizosphereMPLAVLIPLAHAGHILADAAIFGVPVGSVLLTIWGLNRWGPRDE
Ga0247822_1013056733300028592SoilMDPTIFIPLAHAGHVLADAAIFGFPVGSVLLTIFALRRWGPKDN
Ga0307291_107872813300028707SoilMIAEIVIPLAHAGHVLADAAIFGVPVGSILLTIWALNRWGPKDN
Ga0307322_1001247543300028710SoilPMIAEIVIPLAHAGHILADAAIFGVPVGSILLTIWALNRWGPKDN
Ga0307307_1024488023300028718SoilMALLVPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDS
Ga0307317_1007963813300028720SoilRETGDGLMDPTLVIPLAHAGHILADAAIFGVPVGSVLLTIWGLNRWGPKDE
Ga0307317_1030255623300028720SoilMVIPLAHAGHILADAAIFGVPVGSVLLTIFALNRWGPKDQ
Ga0307316_1002515023300028755SoilMDPTLVIPLAHAGHILADAAIFGVPVGSVLLTIWGLNRWGPKDE
Ga0307316_1036017113300028755SoilMALLVPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGP
Ga0307306_1019056713300028782SoilMIAEIFIPVAHAGHVLADAAIFGVPVGSILLTIWALNRWGPKDN
Ga0307299_1001758423300028793SoilMVIPLAHAGHILADAAIFGVPVGSVLLTIWALNRWGPKDS
Ga0247825_1104082123300028812SoilMDPTIFIPLAHAGHVLADAAIFGFPVGSVLLTIFTLRRWGPKDN
Ga0307312_1019279823300028828SoilMGTALANIAVATSLPLAHAGHVLADAAIFGVPVGSVLLTIFALNRWGPR
Ga0307314_1004941313300028872SoilIPLAHAGHILADAAIFGVPVGSILLTIWALNRWGPKDN
Ga0268241_1003583723300030511SoilMTFLLLAHAGHVLADAAIFGVPVGSVVLTIWALNRWGPKDE
Ga0307468_10003162643300031740Hardwood Forest SoilMDPTLVVPLAHAGHILADAAIFGFPVGSVLLTIFALRRWGPKDN
Ga0308175_10236118123300031938SoilVIPLIPLAHAGHVLADAAIFLVPVGSVVLTIFALNRWGPKDR
Ga0308176_1029617923300031996SoilVIPLIPLAHAGHVLADAAIFLVPVGSVVLTIFALSRWGPKDR
Ga0307470_1127756813300032174Hardwood Forest SoilMDPTLVIPLAHAGHIVADAAIFGVPVGSVLLTIWGLN
Ga0307472_10003255423300032205Hardwood Forest SoilMDPTIFIPLAHAGHVLADAAIFGFPVGSVLLTIVALRRWGPKDN
Ga0326726_1006329333300033433Peat SoilMSFRLLGHVGHILADAAIFDVPVGSVLLTIFALNRWGPKDR
Ga0247829_1028942713300033550SoilSDGAGWLPRPMIPLAHAGHVLADAAIFLVPVGSVLLTIFALRRWGPKDR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.