NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093459

Metagenome Family F093459

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093459
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 46 residues
Representative Sequence MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL
Number of Associated Samples 87
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.09 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.62 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.075 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(17.924 % of family members)
Environment Ontology (ENVO) Unclassified
(36.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.755 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 2.17%    Coil/Unstructured: 47.83%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF04879Molybdop_Fe4S4 5.66
PF01738DLH 5.66
PF13376OmdA 4.72
PF07519Tannase 4.72
PF13637Ank_4 3.77
PF05726Pirin_C 2.83
PF08843AbiEii 1.89
PF03551PadR 1.89
PF12796Ank_2 1.89
PF02900LigB 1.89
PF13744HTH_37 1.89
PF00160Pro_isomerase 1.89
PF01053Cys_Met_Meta_PP 1.89
PF01568Molydop_binding 1.89
PF00106adh_short 0.94
PF00196GerE 0.94
PF13432TPR_16 0.94
PF00775Dioxygenase_C 0.94
PF12695Abhydrolase_5 0.94
PF12680SnoaL_2 0.94
PF12625Arabinose_bd 0.94
PF02922CBM_48 0.94
PF07681DoxX 0.94
PF08486SpoIID 0.94
PF01522Polysacc_deac_1 0.94
PF13620CarboxypepD_reg 0.94
PF00135COesterase 0.94
PF08327AHSA1 0.94
PF01565FAD_binding_4 0.94
PF13361UvrD_C 0.94
PF01769MgtE 0.94
PF07676PD40 0.94
PF14534DUF4440 0.94
PF12704MacB_PCD 0.94
PF15902Sortilin-Vps10 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 2.83
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 1.89
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 1.89
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 1.89
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 1.89
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 1.89
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 1.89
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 1.89
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.89
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.89
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.89
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 1.89
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 1.89
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 1.89
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 1.89
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 1.89
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 1.89
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.94
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 0.94
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.94
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.94
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.94
COG2385Peptidoglycan hydrolase (amidase) enhancer domain SpoIIDCell wall/membrane/envelope biogenesis [M] 0.94
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.94
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.08 %
UnclassifiedrootN/A17.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002459|JGI24751J29686_10109609All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005093|Ga0062594_100045144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2197Open in IMG/M
3300005171|Ga0066677_10548183All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005289|Ga0065704_10431473Not Available722Open in IMG/M
3300005295|Ga0065707_10338760All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300005295|Ga0065707_10559230All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300005330|Ga0070690_100055492All Organisms → cellular organisms → Bacteria → Acidobacteria2537Open in IMG/M
3300005331|Ga0070670_100614442All Organisms → cellular organisms → Bacteria → Proteobacteria973Open in IMG/M
3300005331|Ga0070670_102046410All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300005332|Ga0066388_101877151All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300005343|Ga0070687_100125409All Organisms → cellular organisms → Bacteria → Proteobacteria1475Open in IMG/M
3300005356|Ga0070674_101087490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides705Open in IMG/M
3300005365|Ga0070688_100426527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae987Open in IMG/M
3300005444|Ga0070694_101838335Not Available516Open in IMG/M
3300005467|Ga0070706_100631500Not Available994Open in IMG/M
3300005518|Ga0070699_100543130All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300005544|Ga0070686_100821779All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales750Open in IMG/M
3300005549|Ga0070704_100116567All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300005578|Ga0068854_102003386Not Available533Open in IMG/M
3300005617|Ga0068859_100271062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1790Open in IMG/M
3300005719|Ga0068861_100024237All Organisms → cellular organisms → Bacteria4387Open in IMG/M
3300005719|Ga0068861_101981864All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005719|Ga0068861_102094885All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium565Open in IMG/M
3300005840|Ga0068870_10051410All Organisms → cellular organisms → Bacteria2181Open in IMG/M
3300005842|Ga0068858_100790653All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005843|Ga0068860_100283240All Organisms → cellular organisms → Bacteria → Acidobacteria1620Open in IMG/M
3300006844|Ga0075428_100987616Not Available891Open in IMG/M
3300006845|Ga0075421_101467473All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006847|Ga0075431_100051570All Organisms → cellular organisms → Bacteria4242Open in IMG/M
3300006847|Ga0075431_100855525All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300006852|Ga0075433_10378686All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300006880|Ga0075429_101943794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium509Open in IMG/M
3300006969|Ga0075419_10793515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium677Open in IMG/M
3300009094|Ga0111539_10747704All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300009094|Ga0111539_10906350All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1025Open in IMG/M
3300009094|Ga0111539_11488311Not Available785Open in IMG/M
3300009094|Ga0111539_11890225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium692Open in IMG/M
3300009094|Ga0111539_12660489All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans580Open in IMG/M
3300009098|Ga0105245_12463816All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium574Open in IMG/M
3300009100|Ga0075418_10351465All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300009100|Ga0075418_10655695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1131Open in IMG/M
3300009101|Ga0105247_10809276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides716Open in IMG/M
3300009147|Ga0114129_10022629All Organisms → cellular organisms → Bacteria8914Open in IMG/M
3300009147|Ga0114129_13154526Not Available537Open in IMG/M
3300009148|Ga0105243_10750894Not Available956Open in IMG/M
3300009156|Ga0111538_11339969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides903Open in IMG/M
3300009176|Ga0105242_10251151Not Available1594Open in IMG/M
3300009176|Ga0105242_12813248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium537Open in IMG/M
3300009177|Ga0105248_11471640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300009177|Ga0105248_11934462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides669Open in IMG/M
3300009177|Ga0105248_13368418Not Available508Open in IMG/M
3300009527|Ga0114942_1292270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides622Open in IMG/M
3300010041|Ga0126312_11343699Not Available529Open in IMG/M
3300010043|Ga0126380_10400584All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300010362|Ga0126377_13527792All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium506Open in IMG/M
3300010400|Ga0134122_11801854All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium644Open in IMG/M
3300010400|Ga0134122_13146115Not Available516Open in IMG/M
3300011119|Ga0105246_11984796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides561Open in IMG/M
3300012891|Ga0157305_10183591All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300012914|Ga0157297_10491284All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium514Open in IMG/M
3300012927|Ga0137416_10818172All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300013306|Ga0163162_12346560All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → unclassified Leptospiraceae → Leptospiraceae bacterium613Open in IMG/M
3300014157|Ga0134078_10296240All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300014325|Ga0163163_10986052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales906Open in IMG/M
3300014326|Ga0157380_10786224All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300014968|Ga0157379_12236996All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium544Open in IMG/M
3300015371|Ga0132258_10263885All Organisms → cellular organisms → Bacteria → Acidobacteria4216Open in IMG/M
3300015372|Ga0132256_101175423Not Available881Open in IMG/M
3300015372|Ga0132256_102974137All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300015373|Ga0132257_103575516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium565Open in IMG/M
3300015374|Ga0132255_101775344All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium937Open in IMG/M
3300015374|Ga0132255_103605060All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium658Open in IMG/M
3300018000|Ga0184604_10165406All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300018000|Ga0184604_10172352Not Available726Open in IMG/M
3300018028|Ga0184608_10525542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium505Open in IMG/M
3300018067|Ga0184611_1349588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium507Open in IMG/M
3300018429|Ga0190272_12473605All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium565Open in IMG/M
3300018433|Ga0066667_11373281Not Available619Open in IMG/M
3300019356|Ga0173481_10675664All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium554Open in IMG/M
3300021080|Ga0210382_10117334Not Available1121Open in IMG/M
3300021178|Ga0210408_10357207All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300025905|Ga0207685_10778700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300025908|Ga0207643_10046132All Organisms → cellular organisms → Bacteria2463Open in IMG/M
3300025918|Ga0207662_10020350All Organisms → cellular organisms → Bacteria → Proteobacteria3786Open in IMG/M
3300025927|Ga0207687_11017374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300025934|Ga0207686_11321844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300025937|Ga0207669_11917808All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025940|Ga0207691_10191871All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300025960|Ga0207651_10062662All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300025960|Ga0207651_10675564Not Available908Open in IMG/M
3300026035|Ga0207703_10389456All Organisms → cellular organisms → Bacteria → Acidobacteria1291Open in IMG/M
3300026088|Ga0207641_10670570All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300026118|Ga0207675_101707645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300026369|Ga0257152_1025451All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300026499|Ga0257181_1044907All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300027907|Ga0207428_10786961All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium676Open in IMG/M
3300027909|Ga0209382_11565422Not Available653Open in IMG/M
3300028881|Ga0307277_10368878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300031716|Ga0310813_11083912All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300031720|Ga0307469_10129625All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1843Open in IMG/M
3300031940|Ga0310901_10140424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium916Open in IMG/M
3300032003|Ga0310897_10708614Not Available505Open in IMG/M
3300032075|Ga0310890_10180381All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1429Open in IMG/M
3300032122|Ga0310895_10138841All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300032174|Ga0307470_10613049All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium816Open in IMG/M
3300033412|Ga0310810_11149022All Organisms → cellular organisms → Bacteria638Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere17.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere8.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24751J29686_1010960923300002459Corn, Switchgrass And Miscanthus RhizosphereMKYTAHNGRSMTANRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA
Ga0062594_10004514433300005093SoilMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEG
Ga0066677_1054818313300005171SoilMTAKRSRKRVASVREYIASKPKESRSSLEAVRRAILKALPNAQEGLA
Ga0065704_1043147313300005289Switchgrass RhizosphereMTAKRSRKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQM
Ga0065707_1033876033300005295Switchgrass RhizosphereMTAKRSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN
Ga0065707_1055923033300005295Switchgrass RhizosphereMTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEG
Ga0070690_10005549253300005330Switchgrass RhizosphereMTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNA
Ga0070670_10061444213300005331Switchgrass RhizosphereMTAKRSRKRVASVPEYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN
Ga0070670_10204641013300005331Switchgrass RhizosphereMAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPV
Ga0066388_10187715113300005332Tropical Forest SoilVIMAKTAKKRVNSVREYIASQPKESRASLEAVRRAILGAIPT
Ga0070687_10012540913300005343Switchgrass RhizosphereMAMSVSNVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN
Ga0070674_10108749023300005356Miscanthus RhizosphereMTAKRSRKRVALVREYLASKPKESRASLEAVRRAILKALPN
Ga0070688_10042652713300005365Switchgrass RhizosphereMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0070694_10183833513300005444Corn, Switchgrass And Miscanthus RhizosphereMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP
Ga0070706_10063150013300005467Corn, Switchgrass And Miscanthus RhizosphereMTAKRSRNRVASVREYVASKPKESRASLEAVRRAILKALP
Ga0070699_10054313013300005518Corn, Switchgrass And Miscanthus RhizosphereMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPDV
Ga0070686_10082177923300005544Switchgrass RhizosphereMTAKRSRKRVGSVREYVASKPKEARASLEAVRRAILKALPNAQEGLAYQMPAYTL
Ga0070704_10011656713300005549Corn, Switchgrass And Miscanthus RhizosphereMAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEG
Ga0068854_10200338623300005578Corn RhizosphereMTAKRPRKRVASVREYVASKPKESRASLEAVRRAILK
Ga0068859_10027106213300005617Switchgrass RhizosphereMKYTAHNGRSMTANRFRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQE
Ga0068861_10002423753300005719Switchgrass RhizosphereMAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEGLAYQMPA
Ga0068861_10198186423300005719Switchgrass RhizosphereMTAKRSRKRLASVREYIASKPKECRSSLEAVRRAILKALPNAQEGLAY
Ga0068861_10209488513300005719Switchgrass RhizosphereMSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEG
Ga0068870_1005141013300005840Miscanthus RhizosphereMATSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGL
Ga0068858_10079065313300005842Switchgrass RhizosphereMTAKWSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA
Ga0068860_10028324013300005843Switchgrass RhizosphereMSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL
Ga0075428_10098761623300006844Populus RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKAL
Ga0075421_10146747323300006845Populus RhizosphereMSAKRSRKRVASVREYVASKPKDSRASLEAVRRAILKALPNAQEGLA
Ga0075431_10005157013300006847Populus RhizosphereMTAKRSRKRFASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQ
Ga0075431_10085552523300006847Populus RhizosphereVRSMTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGL
Ga0075433_1037868633300006852Populus RhizosphereMTAKRSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY
Ga0075429_10194379413300006880Populus RhizosphereVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY
Ga0075419_1079351513300006969Populus RhizosphereMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMP
Ga0111539_1074770423300009094Populus RhizosphereMRSMTVKRSRKRVASVREYVASKPKESRASLEAVRR
Ga0111539_1090635013300009094Populus RhizosphereMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKA
Ga0111539_1148831123300009094Populus RhizosphereMKYTAHNGRSMTANRSRKRVASVREYVASKPKESRASLEAVRRAILKAL
Ga0111539_1189022513300009094Populus RhizosphereMTAKRPRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYT
Ga0111539_1266048913300009094Populus RhizosphereMTAKQSRKRVASVREYVASKPKESRASLEAVRRAILKALP
Ga0105245_1246381613300009098Miscanthus RhizosphereMTAKRSPGKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEG
Ga0075418_1035146533300009100Populus RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGL
Ga0075418_1065569543300009100Populus RhizosphereMTAKRSRERVASVREYVASKPKESRASLEAVRRAIL
Ga0105247_1080927613300009101Switchgrass RhizosphereMTAKRSRKRVASVREYVASKPKASRASLEAVRRAILKALPNAQEGLACQMPAYTLNGV
Ga0114129_1002262913300009147Populus RhizosphereMVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTL
Ga0114129_1315452623300009147Populus RhizosphereMMAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQE
Ga0105243_1075089423300009148Miscanthus RhizosphereMSAKRSRKRVASVREYVASQPKESRASLEAVRRAILKALPNAQEGLA
Ga0111538_1133996913300009156Populus RhizosphereMTAKRSGKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0105242_1025115113300009176Miscanthus RhizosphereMTAKRSKKRVGSVREYVASKPKEARASLEAVRRAILKALPNAQEGLAYQMPAYT
Ga0105242_1281324823300009176Miscanthus RhizosphereMAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEGLAYQMP
Ga0105248_1147164013300009177Switchgrass RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAI
Ga0105248_1193446213300009177Switchgrass RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0105248_1336841813300009177Switchgrass RhizosphereMTAKRYRKRVGSVREYVASKPKEARASLEAVRRAILKALP
Ga0114942_129227013300009527GroundwaterMAAKQPRRRVASVREYIASKPKESRASLEAVRRAILR
Ga0126312_1134369913300010041Serpentine SoilMTAKRSRRRVASVREYFASMPKESRTSLEAVRRAILKALPNAQE
Ga0126380_1040058413300010043Tropical Forest SoilMVKTAKKRVSPVREYIASKPKESRASLEAVRRAILETIPTVHEGLA
Ga0126377_1352779223300010362Tropical Forest SoilMKAKRSRKRVASVREYIASKPKESRARLEAVRRAILKALPNA
Ga0134122_1180185413300010400Terrestrial SoilMAAKQSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEG
Ga0134122_1314611513300010400Terrestrial SoilMSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA
Ga0105246_1198479633300011119Miscanthus RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEG
Ga0157305_1018359123300012891SoilMTAKRSRKRVASVREYIASKPKESRASLEAVRRSILKALPNAEEGLAY
Ga0157297_1049128423300012914SoilMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTL
Ga0137416_1081817213300012927Vadose Zone SoilMTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGL
Ga0163162_1234656013300013306Switchgrass RhizosphereMTAKRSRTRVASVREYIASKPKASRASLEAVRRAILKAL
Ga0134078_1029624013300014157Grasslands SoilMTAKRSRKRVASVREYIASKPKESRASLDAVRRAILKALPNA
Ga0163163_1098605213300014325Switchgrass RhizosphereMTAKRSPRKRVASVREYIASKPKESRASLEAVRRAILK
Ga0157380_1078622443300014326Switchgrass RhizosphereMTVKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0157379_1223699623300014968Switchgrass RhizosphereMSSMTAKRSRKRVTSVREYVASKPKESRASLEAVRRAILKALPNAQE
Ga0132258_1026388563300015371Arabidopsis RhizosphereMTAKRSRKRLASVREYVASKPKESRASLEAVRRAILKALPNAQ
Ga0132256_10117542323300015372Arabidopsis RhizosphereMTAKRSRKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQMPAYTLNG
Ga0132256_10297413713300015372Arabidopsis RhizosphereMTAKRSRKRIASVREYVASKPKESRASLEAVRRAILKAISNAQEGLAYQMPAYTLNGVGV
Ga0132257_10357551613300015373Arabidopsis RhizosphereMRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0132255_10177534423300015374Arabidopsis RhizosphereMRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPKAQEGLAYQMPAYTL
Ga0132255_10360506023300015374Arabidopsis RhizosphereMTAKRSGKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQMPAYTLNGVG
Ga0184604_1016540633300018000Groundwater SedimentMTAKRSRKRVASVREYVASKPKESRASLEAVRRAIL
Ga0184604_1017235213300018000Groundwater SedimentMSAKRSRKRVASVREYVASKPKESRASLEAVRRAI
Ga0184608_1052554223300018028Groundwater SedimentMTAKRSRKRVASVREYGASKPKESRASLEAVRRAILKALPNAQEGLAY
Ga0184611_134958823300018067Groundwater SedimentMSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0190272_1247360523300018429SoilMTAKRARKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAY
Ga0066667_1137328123300018433Grasslands SoilMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0173481_1067566423300019356SoilMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILNALPNAQEGLAYQMPAYTLN
Ga0210382_1011733413300021080Groundwater SedimentMTAKRSRKRVASVRDYVASKPKESRASLEAVRRAILKALPDAQEG
Ga0210408_1035720723300021178SoilMAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP
Ga0207685_1077870023300025905Corn, Switchgrass And Miscanthus RhizosphereVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0207643_1004613223300025908Miscanthus RhizosphereMATSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKAIP
Ga0207662_1002035043300025918Switchgrass RhizosphereMAMSVNNVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILK
Ga0207687_1101737423300025927Miscanthus RhizosphereMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKA
Ga0207686_1132184423300025934Miscanthus RhizosphereMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY
Ga0207669_1191780813300025937Miscanthus RhizosphereMTAKRSGKRVASVREYIASKPKESRASLEAVRRAILKALPTAQ
Ga0207691_1019187113300025940Miscanthus RhizosphereMAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0207651_1006266213300025960Switchgrass RhizosphereMTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPA
Ga0207651_1067556423300025960Switchgrass RhizosphereMAAKRPRKRVASVREYVASKPKESRASLEAVRRAILKAVPNAQEGLAYQMPA
Ga0207703_1038945623300026035Switchgrass RhizosphereMTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMP
Ga0207641_1067057023300026088Switchgrass RhizosphereMAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGLA
Ga0207675_10170764523300026118Switchgrass RhizosphereMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILK
Ga0257152_102545123300026369SoilMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQ
Ga0257181_104490723300026499SoilMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL
Ga0207428_1078696113300027907Populus RhizosphereLLRSMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN
Ga0209382_1156542213300027909Populus RhizosphereMTAKRSRKRFASVREYVASKPKESRASLEAVRRAI
Ga0307277_1036887813300028881SoilMSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP
Ga0310813_1108391223300031716SoilMAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQM
Ga0307469_1012962513300031720Hardwood Forest SoilMTAKRSRKRVASVREYVASKPKEHRASLEAVRRAILKALPNAQEGLAYQMP
Ga0310901_1014042413300031940SoilMRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL
Ga0310897_1070861413300032003SoilMTAKRSRKRVASVREYVASKPRESRASLEAVRRAILK
Ga0310890_1018038133300032075SoilMRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPK
Ga0310895_1013884123300032122SoilMTAKRSRKRVASVREYLASKPKESRASLGAVRRAILKA
Ga0307470_1061304913300032174Hardwood Forest SoilMAAKRSRKRVASVREYVLSKPKESRASLEAVRRAILKA
Ga0310810_1114902213300033412SoilMAMSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.