Metagenome / Metatranscriptome Family F093422

Basic Information
Family ID	F093422
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	39 residues
Representative Sequence	HQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKTFGEL
Number of Associated Samples	98
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	9.43 %
% of genes near scaffold ends (potentially truncated)	83.02 %
% of genes from short scaffolds (< 2000 bps)	87.74 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.60

Most Common Taxonomy
Group	Bacteria (60.377 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (7.547 % of family members)
Environment Ontology (ENVO)	Unclassified (18.868 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (39.623 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF13683	rve_3	22.64
PF00665	rve	16.04
PF13426	PAS_9	1.89
PF01850	PIN	1.89
PF01527	HTH_Tnp_1	1.89
PF04357	TamB	0.94
PF00078	RVT_1	0.94
PF08281	Sigma70_r4_2	0.94
PF13396	PLDc_N	0.94
PF02371	Transposase_20	0.94
PF13333	rve_2	0.94
PF08388	GIIM	0.94
PF00589	Phage_integrase	0.94
PF00701	DHDPS	0.94
PF16655	PhoD_N	0.94
PF13649	Methyltransf_25	0.94
PF02687	FtsX	0.94
PF01103	Omp85	0.94
PF01797	Y1_Tnp	0.94
PF11949	DUF3466	0.94
PF11954	DUF3471	0.94
PF03061	4HBT	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	16.04
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	16.04
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	16.04
COG4584	Transposase	Mobilome: prophages, transposons [X]	16.04
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	1.89
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.94
COG2911	Phospholipid transport to the outer membrane protein TamB	Cell wall/membrane/envelope biogenesis [M]	0.94
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.26 %
Unclassified	root	N/A	37.74 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	60.38 %
Unclassified	root	N/A	37.74 %
Viruses	superkingdom	All Organisms → Viruses	1.89 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	60.38 %
Unclassified	root	N/A	37.74 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	22.64 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	10.38 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	8.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	18.87 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	10.38 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.83 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	18.87 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	9.43 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Candidatus Angelobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	9.43 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	3.77 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.94 %
unclassified Candidatus Angelobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	9.43 %
Desulfobulbaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae	3.77 %
Syntrophotaleaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.94 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Singulisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	9.43 %
Desulfobulbus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus	3.77 %
Syntrophotalea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae → Syntrophotalea	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Acidobacteriaceae bacterium URHE0068	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	0.94 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
unclassified Singulisphaera	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera	9.43 %
Desulfobulbus propionicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus propionicus	2.83 %
Syntrophotalea carbinolica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae → Syntrophotalea → Syntrophotalea carbinolica	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Acidobacteriaceae bacterium URHE0068	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	0.94 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.74 %
Singulisphaera sp. GP187	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	9.43 %
Desulfobulbus propionicus DSM 2032	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus propionicus → Desulfobulbus propionicus DSM 2032	2.83 %
Syntrophotalea carbinolica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae → Syntrophotalea → Syntrophotalea carbinolica	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.89 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.89 %
Acidobacteriaceae bacterium URHE0068	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	0.94 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.94 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000597\|AF_2010_repII_A1DRAFT_10122238	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	635	Open in IMG/M
3300003541\|JGI20214J51650_11127188	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300004082\|Ga0062384_101162564	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae → Syntrophotalea → Syntrophotalea carbinolica	559	Open in IMG/M
3300004633\|Ga0066395_10134609	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300005167\|Ga0066672_10075796	All Organisms → cellular organisms → Bacteria	2000	Open in IMG/M
3300005364\|Ga0070673_100245066	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1560	Open in IMG/M
3300005530\|Ga0070679_101702464	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	578	Open in IMG/M
3300005543\|Ga0070672_100292214	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1380	Open in IMG/M
3300005544\|Ga0070686_100435347	All Organisms → Viruses → Predicted Viral	1005	Open in IMG/M
3300005548\|Ga0070665_102088640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	571	Open in IMG/M
3300005576\|Ga0066708_11030159	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Syntrophotaleaceae → Syntrophotalea → Syntrophotalea carbinolica	511	Open in IMG/M
3300005591\|Ga0070761_10334367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	916	Open in IMG/M
3300005841\|Ga0068863_100546427	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1143	Open in IMG/M
3300005843\|Ga0068860_100913110	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	894	Open in IMG/M
3300006059\|Ga0075017_100305261	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus	1176	Open in IMG/M
3300006162\|Ga0075030_100132380	All Organisms → cellular organisms → Bacteria → Proteobacteria	2023	Open in IMG/M
3300006854\|Ga0075425_100361640	All Organisms → cellular organisms → Bacteria → Proteobacteria	1671	Open in IMG/M
3300009012\|Ga0066710_100649404	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300009038\|Ga0099829_10667619	Not Available	864	Open in IMG/M
3300009083\|Ga0105047_10751421	Not Available	843	Open in IMG/M
3300009084\|Ga0105046_10360806	Not Available	1497	Open in IMG/M
3300009090\|Ga0099827_11956438	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300009162\|Ga0075423_12544158	Not Available	559	Open in IMG/M
3300009171\|Ga0105101_10268533	Not Available	824	Open in IMG/M
3300009174\|Ga0105241_11040656	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus propionicus → Desulfobulbus propionicus DSM 2032	768	Open in IMG/M
3300009400\|Ga0116854_1135726	Not Available	1110	Open in IMG/M
3300009523\|Ga0116221_1407482	Not Available	592	Open in IMG/M
3300009632\|Ga0116102_1051545	Not Available	1291	Open in IMG/M
3300009650\|Ga0105857_1274616	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300009759\|Ga0116101_1012882	Not Available	1555	Open in IMG/M
3300009824\|Ga0116219_10441508	Not Available	723	Open in IMG/M
3300010048\|Ga0126373_10119064	All Organisms → cellular organisms → Bacteria → Proteobacteria	2467	Open in IMG/M
3300010339\|Ga0074046_10217818	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1195	Open in IMG/M
3300010339\|Ga0074046_10591238	Not Available	657	Open in IMG/M
3300010362\|Ga0126377_12182079	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	630	Open in IMG/M
3300010362\|Ga0126377_12386902	Not Available	605	Open in IMG/M
3300010366\|Ga0126379_10731239	All Organisms → cellular organisms → Bacteria → Proteobacteria	1085	Open in IMG/M
3300012096\|Ga0137389_10826669	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	795	Open in IMG/M
3300012133\|Ga0137329_1051723	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	539	Open in IMG/M
3300012189\|Ga0137388_11576449	Not Available	593	Open in IMG/M
3300012202\|Ga0137363_11572877	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	549	Open in IMG/M
3300012357\|Ga0137384_11383635	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	552	Open in IMG/M
3300012361\|Ga0137360_10625269	Not Available	922	Open in IMG/M
3300012362\|Ga0137361_11951116	Not Available	503	Open in IMG/M
3300014156\|Ga0181518_10006226	All Organisms → cellular organisms → Bacteria → Acidobacteria	10035	Open in IMG/M
3300014168\|Ga0181534_10294808	Not Available	873	Open in IMG/M
3300014491\|Ga0182014_10222021	Not Available	1008	Open in IMG/M
3300014491\|Ga0182014_10295086	Not Available	834	Open in IMG/M
3300014498\|Ga0182019_10164046	Not Available	1416	Open in IMG/M
3300016750\|Ga0181505_10545585	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	3089	Open in IMG/M
3300017822\|Ga0187802_10002261	All Organisms → cellular organisms → Bacteria	5411	Open in IMG/M
3300017933\|Ga0187801_10343789	Not Available	613	Open in IMG/M
3300017940\|Ga0187853_10387492	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300017955\|Ga0187817_10027790	All Organisms → cellular organisms → Bacteria → Acidobacteria	3410	Open in IMG/M
3300017972\|Ga0187781_10283393	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	1175	Open in IMG/M
3300017975\|Ga0187782_10074259	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2484	Open in IMG/M
3300018022\|Ga0187864_10041893	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2628	Open in IMG/M
3300018061\|Ga0184619_10385885	Not Available	636	Open in IMG/M
3300018065\|Ga0180430_10288266	Not Available	1115	Open in IMG/M
3300018468\|Ga0066662_12917093	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	508	Open in IMG/M
3300018469\|Ga0190270_11541869	Not Available	715	Open in IMG/M
3300020213\|Ga0163152_10175340	Not Available	1198	Open in IMG/M
3300021088\|Ga0210404_10572212	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	641	Open in IMG/M
3300021405\|Ga0210387_10901715	Not Available	778	Open in IMG/M
3300021441\|Ga0213871_10280087	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300021560\|Ga0126371_10930123	Not Available	1013	Open in IMG/M
3300021560\|Ga0126371_10931872	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	1012	Open in IMG/M
3300021560\|Ga0126371_12189515	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300021560\|Ga0126371_13801606	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300022850\|Ga0224552_1009438	Not Available	1333	Open in IMG/M
3300025463\|Ga0208193_1012052	All Organisms → cellular organisms → Bacteria	2613	Open in IMG/M
3300025944\|Ga0207661_10590741	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1019	Open in IMG/M
3300026333\|Ga0209158_1131961	All Organisms → cellular organisms → Bacteria → Acidobacteria	927	Open in IMG/M
3300027692\|Ga0209530_1173980	Not Available	599	Open in IMG/M
3300027855\|Ga0209693_10577149	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	532	Open in IMG/M
3300027867\|Ga0209167_10779410	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	521	Open in IMG/M
3300028560\|Ga0302144_10144838	Not Available	768	Open in IMG/M
3300028759\|Ga0302224_10172823	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	851	Open in IMG/M
3300028780\|Ga0302225_10107094	All Organisms → cellular organisms → Bacteria	1364	Open in IMG/M
3300028866\|Ga0302278_10373175	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	639	Open in IMG/M
3300029913\|Ga0311362_10375111	Not Available	1414	Open in IMG/M
3300029913\|Ga0311362_10459517	Not Available	1207	Open in IMG/M
3300030019\|Ga0311348_10601084	Not Available	821	Open in IMG/M
3300030047\|Ga0302286_10068946	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1848	Open in IMG/M
3300031090\|Ga0265760_10130598	Not Available	812	Open in IMG/M
3300031231\|Ga0170824_118218530	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	572	Open in IMG/M
3300031234\|Ga0302325_11785950	Not Available	772	Open in IMG/M
3300031261\|Ga0302140_11143735	Not Available	524	Open in IMG/M
3300031715\|Ga0307476_11342703	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300031718\|Ga0307474_10443264	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300031718\|Ga0307474_11410062	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus propionicus → Desulfobulbus propionicus DSM 2032	549	Open in IMG/M
3300031753\|Ga0307477_10967260	Not Available	560	Open in IMG/M
3300031845\|Ga0318511_10361587	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	662	Open in IMG/M
3300031954\|Ga0306926_10800594	All Organisms → cellular organisms → Bacteria	1136	Open in IMG/M
3300032001\|Ga0306922_11680759	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300032054\|Ga0318570_10088762	Not Available	1338	Open in IMG/M
3300032067\|Ga0318524_10158854	Not Available	1146	Open in IMG/M
3300032156\|Ga0315295_10705590	All Organisms → Viruses → Predicted Viral	1018	Open in IMG/M
3300032263\|Ga0316195_10771205	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300032805\|Ga0335078_10125557	All Organisms → cellular organisms → Bacteria	3666	Open in IMG/M
3300032828\|Ga0335080_10393420	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus propionicus → Desulfobulbus propionicus DSM 2032	1488	Open in IMG/M
3300033134\|Ga0335073_10037827	All Organisms → cellular organisms → Bacteria	6558	Open in IMG/M
3300033289\|Ga0310914_11868864	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	505	Open in IMG/M
3300033486\|Ga0316624_10911173	Not Available	788	Open in IMG/M
3300034109\|Ga0335051_0407952	Not Available	643	Open in IMG/M
3300034163\|Ga0370515_0000158	All Organisms → cellular organisms → Bacteria → Acidobacteria	26955	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.51%
Host-Associated	Host-Associated	8.49%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	67.92%
Aquatic	Environmental → Aquatic	23.58%
Plants	Host-Associated → Plants	8.49%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.55%
Freshwater	Environmental → Aquatic → Freshwater	16.98%
Peat	Environmental → Terrestrial → Peat	10.38%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.60%
Sediment	Environmental → Aquatic → Sediment	3.77%
Marine	Environmental → Aquatic → Marine	1.89%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.89%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.68%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	12.26%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	11.32%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	10.38%
Loam	Environmental → Terrestrial → Soil → Loam	6.60%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.77%
Lake	Environmental → Aquatic → Freshwater → Lake	2.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.83%
Ice	Environmental → Aquatic → Freshwater → Ice	1.89%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Coastal	Environmental → Aquatic → Marine → Coastal	0.94%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.94%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.21%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	10.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.49%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	5.66%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.77%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.77%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.83%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.83%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.89%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.94%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.94%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.94%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	0.94%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.55%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.66%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	4.72%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.77%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.77%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.83%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	2.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.83%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.89%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	1.89%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.89%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.89%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.89%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.89%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	1.89%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.89%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.89%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.89%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.94%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.94%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.94%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.94%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.94%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Sediment	0.94%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.94%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	0.94%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.94%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.94%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.94%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.94%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.94%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.94%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009083	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)	Environmental	Open in IMG/M
3300009084	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009400	Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858	Environmental	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental	Open in IMG/M
3300009759	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10	Environmental	Open in IMG/M
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012133	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014491	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG	Environmental	Open in IMG/M
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental	Open in IMG/M
3300016750	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017940	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018022	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018065	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300020213	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Host-Associated	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022850	Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5	Environmental	Open in IMG/M
3300025463	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300027692	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)	Environmental	Open in IMG/M
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028560	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2	Environmental	Open in IMG/M
3300028759	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1	Environmental	Open in IMG/M
3300028780	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2	Environmental	Open in IMG/M
3300028866	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2	Environmental	Open in IMG/M
3300029913	III_Bog_N3 coassembly	Environmental	Open in IMG/M
3300030019	II_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031261	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032263	Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034163	Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.60
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.60
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F093422

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AF_2010_repII_A1DRAFT_101222381	3300000597	Forest Soil	ERIDYLEKKIQNKDAVLAELMAEHVTLKKTLGEL*
JGI20214J51650_111271881	3300003541	Wetland	KARANHQAEQERIEYLEKKIQRKDEVLAELMGEHIALKKTLGEL*
Ga0062384_1011625642	3300004082	Bog Forest Soil	GGRGHQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKSFGEL*
Ga0066395_101346092	3300004633	Tropical Forest Soil	MCGPSRQAEEKQKRAEFLEKKVQTEDEVLAEPMAEHIELK*
Ga0066672_100757965	3300005167	Soil	FQGKSRPDHQAEQQRIEFLEKKIQTKDEVLAELMAEHIALK*
Ga0070673_1002450661	3300005364	Switchgrass Rhizosphere	DQQAEKDRIEFLEKKIQRKDEVLAELMGEYVALKKELGEL*
Ga0070679_1017024641	3300005530	Corn Rhizosphere	KKAAQISQAEKERIEFLEKKIQRKDEVLAELMGEYVALKKELGEL*
Ga0070672_1002922143	3300005543	Miscanthus Rhizosphere	RPDQQAEKDRIEFLEKKIQRKDEVLAELMGKYVALKKELGEL*
Ga0070686_1004353473	3300005544	Switchgrass Rhizosphere	RPNHSAEQERIAYLEKKIQTRDEVLAELMAEHVAVKKDIGEL*
Ga0070665_1020886402	3300005548	Switchgrass Rhizosphere	DQRAEKERVEFLEKKIQRKDEVLAELMGEYVALKKELGEL*
Ga0066708_110301592	3300005576	Soil	QQHIEKLEKKIRQKDEVLAELMAEHIALKKELGDL*
Ga0070761_103343672	3300005591	Soil	GRGHQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKSFGEL*
Ga0068863_1005464271	3300005841	Switchgrass Rhizosphere	DQQTEKERIEFLEKKIRRKDEVLAELMGEYVALKKELGEL*
Ga0068860_1009131102	3300005843	Switchgrass Rhizosphere	RNQDQQRIEKLEQKIRQKDEVLAELMAEHIALKKEFGEL*
Ga0075017_1003052611	3300006059	Watersheds	ERIDYLQKKIQVKDEVLAELMAEHVALKKSLGEL*
Ga0075030_1001323803	3300006162	Watersheds	HQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKTFGEL*
Ga0075425_1003616402	3300006854	Populus Rhizosphere	VEEKQKRIEFLEKKVQTKDEVLAELMAEHIALKKTLGEL*
Ga0066710_1006494041	3300009012	Grasslands Soil	VEEKQKRIEFLEKKVQTKDEILAELMAEHIALKKALGNSNRDLGAA
Ga0099829_106676191	3300009038	Vadose Zone Soil	PNHQAEQERIAHLERKIQTKDEVLAELMAEHVSLKKRLGEL*
Ga0105047_107514211	3300009083	Freshwater	KRIEYLEKKIQVKDEVLAELMAEHVALKKSHGAL*
Ga0105046_103608061	3300009084	Freshwater	RNKDLERIEKLEGRLRQKDEVIAELLTEHIALKKEFGDL*
Ga0099827_119564382	3300009090	Vadose Zone Soil	QERIDHLEKKIQTKDEVLAELMAEHVAPKKTLGEL*
Ga0075423_125441581	3300009162	Populus Rhizosphere	RGCSAEQERISYLARKMQTKDDVLAELMAEHVTLKREIGEL*
Ga0105101_102685331	3300009171	Freshwater Sediment	ERIIYLEKKIQTKDEVLAELMAEHVALKKDIGEL*
Ga0105241_110406561	3300009174	Corn Rhizosphere	GKRPERNQDQQRIEKLENKIRQKDEVLAELMAEHISLKKEFGEL*
Ga0116854_11357262	3300009400	Soil	MEEKQKRIEFLEKKVQTEDEVLAEHIAPKKVLGNS
Ga0116221_14074821	3300009523	Peatlands Soil	QKRIEFLEKKVQTKDEVLAELMAEHIALKKSVGEL*
Ga0116102_10515451	3300009632	Peatland	RQAEEKQKRIEFLEKKVQTKDEVLAELMAEHIALKKSRGEL*
Ga0105857_12746161	3300009650	Permafrost Soil	QERIEYLERKIQTKDEVLAELMAEHIALKKSFGEL*
Ga0116101_10128821	3300009759	Peatland	QQKIEKLEQKIRQKDEVLAELMAEYIGLKKEFGEL*
Ga0116219_104415081	3300009824	Peatlands Soil	EKQKRIEFLEKKVQTKDEVLAELMAEHIALKKSVGEL*
Ga0126373_101190641	3300010048	Tropical Forest Soil	KRIEFLEKKVQTKDEVLAELIAEHVAQKKSLGEL*
Ga0074046_102178183	3300010339	Bog Forest Soil	VEEKQKRIEFLEKKVQTKNEVLAGLMAEHVALKKTLGEL*
Ga0074046_105912381	3300010339	Bog Forest Soil	QVEEKQKRIEFLEKKVQTKDEVLAELMAEHIALKKSFGEL*
Ga0126377_121820791	3300010362	Tropical Forest Soil	VAFQPKNRPDHQTERERIEFLEKKIQRKDEVLAELMAEHVTLKKTLGEL*
Ga0126377_123869021	3300010362	Tropical Forest Soil	GQDQHRIEKLEQKIRQKDEVLAELMAEHISLKRELGEL*
Ga0126379_107312391	3300010366	Tropical Forest Soil	ADQERIAYLEKKIQTKDEVLAELMAEHVAVKKTLGEL*
Ga0137389_108266692	3300012096	Vadose Zone Soil	NHQAEQERIAHLERKIQTKDEVLAELMAEHVSLKKRLGEL*
Ga0137329_10517231	3300012133	Soil	EQERIEFLQKKIQRKDEVLAELMAEHIALKKELGEL*
Ga0137388_115764492	3300012189	Vadose Zone Soil	ERIAYVEKKIQTKDEVLAELMAAHVALKKETGEL*
Ga0137363_115728771	3300012202	Vadose Zone Soil	RRGLHTLQKKIQTKDEVLAELMAEHVALRKDIGEL*
Ga0137384_113836351	3300012357	Vadose Zone Soil	QERIEFLQKKIQRKDEVLAELMAEHIALKKELGEL*
Ga0137360_106252691	3300012361	Vadose Zone Soil	GKSRPDHQAEQQRIEFLEKKIQTKDEGLAELLAEHIALKKSFGEL*
Ga0137361_119511162	3300012362	Vadose Zone Soil	PEHKDEQKRIEFLEKKIQTKDEVLAELMAEHIALKKSFGEL*
Ga0181518_100062266	3300014156	Bog	VEEKQRRIEFLEKKVQTKNGVLAELMAEHDALIKTLGEL*
Ga0181534_102948082	3300014168	Bog	HQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKSFGEL*
Ga0182014_102220211	3300014491	Bog	AEEKQKRIEFLEKKVQTKDEVLAELIAQHIALKKGLGEL*
Ga0182014_102950861	3300014491	Bog	HQAEQERIAYLEKKMQRKDEVLAERMAEHIALKKELGEL*
Ga0182019_101640461	3300014498	Fen	PQQQRIEYLEKKIQTKDEVLAELMAEHVALNKSLGGI*
Ga0181505_105455856	3300016750	Peatland	QKRIEFLEKKVQTKDEVLAELMAEHIALKKSLVEL
Ga0187802_100022611	3300017822	Freshwater Sediment	RPRRQAEEKQKRIEFLEKKVQTKDEVLAELMAEHIALRKSLGEL
Ga0187801_103437892	3300017933	Freshwater Sediment	EEKQKRIEFLEKKVQTKDEVLAELMAEHIALRKSLGEL
Ga0187853_103874921	3300017940	Peatland	GHQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKSFGEL
Ga0187817_100277904	3300017955	Freshwater Sediment	ERPRRQAEEKQKRIEFLEKKVQTKDEVLAELMAEHIALRKSLGEL
Ga0187781_102833932	3300017972	Tropical Peatland	VEEKQKRIEFLEKKVQTKDEVLAELMAEHIALKKTLGEL
Ga0187782_100742593	3300017975	Tropical Peatland	VEEKQKRIEFLEEKVQTKDEVLAELMAEHIALRKSLGKL
Ga0187864_100418932	3300018022	Peatland	VEEKQRRIEFLEKKVQTKNGVLAELMAEHDALIKTLGEL
Ga0184619_103858852	3300018061	Groundwater Sediment	AEQERIEFLQKKIQRKDEVLAELMAEHIALKKELGEL
Ga0180430_102882661	3300018065	Hypersaline Lake Sediment	EKKIAKLESKLQQKDSVLAELMADYVAVKKTLGDG
Ga0066662_129170932	3300018468	Grasslands Soil	DQQAEKERIEFLEKKIQRKDEVLAELMGEYVALKKELGEL
Ga0190270_115418692	3300018469	Soil	SEEHARIEKLQSKIRQKDEVLAELLAEHVALKKEFGEL
Ga0163152_101753401	3300020213	Freshwater Microbial Mat	RNKDLERIDKLEGRLRKKDEVIAELLTEHIALKKEFGDL
Ga0210404_105722122	3300021088	Soil	PEQERIAYLEQKIQTKDEVLAELMAEHIALKKRVGEL
Ga0210387_109017151	3300021405	Soil	SDHQAEQERIEFLEKKIQRKDEVLAELMGEYVALKKELGEL
Ga0213871_102800871	3300021441	Rhizosphere	EQERIEKLEKKIQQKDAVLAELMAEHVALKKELGEL
Ga0126371_109301231	3300021560	Tropical Forest Soil	QKRIEFLEKKVQTKDEVLAELMAEHIALKKNLGEP
Ga0126371_109318723	3300021560	Tropical Forest Soil	MCGPSRQAEEKQKRAEFLEKKVQTEDEVLAEPMAEHIELK
Ga0126371_121895151	3300021560	Tropical Forest Soil	VEEKQKRIEFLEKKVQTKDEVLAELMAEHIELKKELGEL
Ga0126371_138016061	3300021560	Tropical Forest Soil	NNHSDDQERIAYLENRIQSKDEVLTELMAEHVILKKRFGEL
Ga0224552_10094383	3300022850	Soil	KRTERHPEQQKIEKLEQKIRQKDEVLAELMAEYIALKKEFGEL
Ga0208193_10120522	3300025463	Peatland	VEEKQKRIEFLEKKVKTKDEVLAELMAEHIALKKHLGSSNRQLGAA
Ga0207661_105907412	3300025944	Corn Rhizosphere	KRPPNHSTDQERVAYLEKKIQTKDEVLAELMAEHIALKKTLGEL
Ga0209158_11319611	3300026333	Soil	NHSAEQERIAQAEKKIQTKDEAKLMAEHVALKKRLGEL
Ga0209530_11739801	3300027692	Forest Soil	VDTHTPFNYSADQERITYLEKRIRTKDEVLAEMMAEHVAINKCLGRFPEN
Ga0209693_105771491	3300027855	Soil	QVEEKQKRIEFLEKKVQTKDEVLAELMAEHIALKKTLGEL
Ga0209167_107794102	3300027867	Surface Soil	LARPNHSADQERIAYLEKKIQTKDEVLAELMAEHVAVKKTLGEL
Ga0302144_101448382	3300028560	Bog	PHRQVEEKQERIGFLEKKVQTKDEGLAELMAEPVALKKPLGKNR
Ga0302224_101728231	3300028759	Palsa	VEEKQRRIEFLEKKVQTKDEVLAELMAEHIALKKTLGEL
Ga0302225_101070942	3300028780	Palsa	VEEKRKRIEFLEKKVQTRDEVLAEHIALRKSLGEL
Ga0302278_103731751	3300028866	Bog	QERIEYLTKKIQTKDEVLAELMAEHLALKKSLGEI
Ga0311362_103751111	3300029913	Bog	EQKGGRSHQAEQERIEYLEKKIQTKDEVLAELMAEHIALKKSFGEL
Ga0311362_104595172	3300029913	Bog	ERGKDQERIVKLEQKIQQKNEVLAELMMEHVALKKALGEL
Ga0311348_106010842	3300030019	Fen	QKRPSNHSAEQERIAYLEKKIQTKDEVLAELMAEYVAFKKEIGEL
Ga0302286_100689463	3300030047	Fen	LTKSRPNQQPQQQRIEYLEKKIQTKDEVLAELMAEHVALNKSLGGI
Ga0265760_101305981	3300031090	Soil	AEQERSAHLERKIQTKDKVLAALMAEHVALKKRVGEL
Ga0170824_1182185302	3300031231	Forest Soil	VHPRPSRVVAYLEKKIQTKGEVLAELMAEHITLKKTLGEL
Ga0302325_117859502	3300031234	Palsa	EQERIEYLEKKIQTKDEVLAELMAEHISLMTTGSPETAVR
Ga0302140_111437351	3300031261	Bog	VGDKRNRDQQRIEKLEQKIQLKNELLAGLMAEHVAQKKNREF
Ga0307476_113427031	3300031715	Hardwood Forest Soil	FQAKARADHHAEQDRIELLEQRIQRKDEVLAELMAEHIALKKALGEL
Ga0307474_104432641	3300031718	Hardwood Forest Soil	NDSADEERIAYLEKNIRTRDEVLAELMAESIALKKALGEV
Ga0307474_114100621	3300031718	Hardwood Forest Soil	AKARADHHAEQDRIEFLEQRIQRKDEVLAELMAEHIALKKALGEL
Ga0307477_109672601	3300031753	Hardwood Forest Soil	EQERIEFLQKKIQRKDEVLAELMAEHIALKKELGEL
Ga0318511_103615873	3300031845	Soil	NHQPQQERIAHLEKKVQTKDEVLAELMAEHVALKKVGEL
Ga0306926_108005941	3300031954	Soil	DQERIAYLEKKIQTKDEVLAELMAEHLEVKKTLGEL
Ga0306922_116807591	3300032001	Soil	SADQERIAYLEKKIQTKDEVLAELMAEHLAVKKTLGEL
Ga0318570_100887622	3300032054	Soil	AKARSDHQAEKDRIEFLEKKIQRKDEVLAELMSEYIALKKELGEL
Ga0318524_101588541	3300032067	Soil	EKERIEFLEKKIQRKDEVLAELMGEYVALKKELGEL
Ga0315295_107055902	3300032156	Sediment	EQERIAYLEKKIQTKDEVLAELMAEYVALKKTLGEL
Ga0316195_107712051	3300032263	Sediment	AEQERVAYLGKTIQSKNEVLLELMAEYVALTKTLGEL
Ga0335078_101255574	3300032805	Soil	VVEKQKRIEFLEKKVQTKDEVLAELMAQHIALKKTLGEL
Ga0335080_103934202	3300032828	Soil	VRVLSSEGHRIFSIKQKIRQKDEVLVELMAEHVALKKELGEL
Ga0335073_100378273	3300033134	Soil	VVEKQKRIEFLEKKVQTEDEVLAELMAQHIALKKTLGEL
Ga0310914_118688642	3300033289	Soil	QKRPSNHSADQERIAYLEKKIQTKDEVLAELMAEHVVLKKTLGEL
Ga0316624_109111731	3300033486	Soil	VRPSHSAEQERIDYSVKKIQTKDEVLAELMAEHVAL
Ga0335051_0407952_525_641	3300034109	Freshwater	NKEQERIQKLESRLRQKDEVIAELLTEHIALKKEFGDL
Ga0370515_0000158_16168_16287	3300034163	Untreated Peat Soil	VEEKQKRIEFLEKKVQTKDDVPAELMAEHIALKKTLGEL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign