NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093408

Metagenome / Metatranscriptome Family F093408

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093408
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 88 residues
Representative Sequence VLKRRNVRNRMRPWIATVAAYALALQVLLTGVAAGHVMAAGDASASSLFVICHGNGSSDDQGLPGKAPLAQSPCMLCTLAKAPCAILPSDH
Number of Associated Samples 81
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.85 %
% of genes near scaffold ends (potentially truncated) 91.51 %
% of genes from short scaffolds (< 2000 bps) 96.23 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.283 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.283 % of family members)
Environment Ontology (ENVO) Unclassified
(72.642 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.113 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.97%    β-sheet: 3.36%    Coil/Unstructured: 59.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03544TonB_C 5.66
PF13586DDE_Tnp_1_2 3.77
PF02663FmdE 3.77
PF03401TctC 2.83
PF04392ABC_sub_bind 2.83
PF01618MotA_ExbB 2.83
PF03824NicO 0.94
PF13340DUF4096 0.94
PF00239Resolvase 0.94
PF02777Sod_Fe_C 0.94
PF03446NAD_binding_2 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 5.66
COG2191Formylmethanofuran dehydrogenase subunit EEnergy production and conversion [C] 3.77
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.83
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.83
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.94
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.94
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0624880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300005363|Ga0008090_15695535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → unclassified Chelatococcus → Chelatococcus sp. GW1503Open in IMG/M
3300005363|Ga0008090_15886275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300005764|Ga0066903_101033597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1506Open in IMG/M
3300006871|Ga0075434_101600358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300006953|Ga0074063_10050865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300009012|Ga0066710_104421852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300010048|Ga0126373_12831108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300010361|Ga0126378_10744858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1091Open in IMG/M
3300010362|Ga0126377_10857465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7969Open in IMG/M
3300012199|Ga0137383_10639685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300012202|Ga0137363_10774134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium814Open in IMG/M
3300012208|Ga0137376_11653973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300012211|Ga0137377_11528629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300012975|Ga0134110_10511091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300012984|Ga0164309_11756196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300012985|Ga0164308_11501847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300016270|Ga0182036_10285636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1249Open in IMG/M
3300016270|Ga0182036_10573979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium902Open in IMG/M
3300016270|Ga0182036_11426010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300016294|Ga0182041_11095265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300016319|Ga0182033_10214884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1539Open in IMG/M
3300016319|Ga0182033_11240624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300016319|Ga0182033_11365350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300016341|Ga0182035_11984136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300016387|Ga0182040_10802041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300016422|Ga0182039_10629783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium940Open in IMG/M
3300016422|Ga0182039_10763444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300016445|Ga0182038_10863117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales796Open in IMG/M
3300016445|Ga0182038_11930300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300018431|Ga0066655_10345468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium976Open in IMG/M
3300021168|Ga0210406_10522705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium936Open in IMG/M
3300021178|Ga0210408_10987818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300021432|Ga0210384_11045000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300021439|Ga0213879_10052947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1076Open in IMG/M
3300025905|Ga0207685_10180180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium979Open in IMG/M
3300028536|Ga0137415_10268744All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300028784|Ga0307282_10618599Not Available525Open in IMG/M
3300028828|Ga0307312_10255611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1134Open in IMG/M
3300031544|Ga0318534_10326015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria885Open in IMG/M
3300031545|Ga0318541_10595890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300031561|Ga0318528_10181769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300031561|Ga0318528_10391168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300031572|Ga0318515_10439788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300031572|Ga0318515_10443128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium694Open in IMG/M
3300031572|Ga0318515_10529825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300031640|Ga0318555_10370086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300031640|Ga0318555_10458453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300031679|Ga0318561_10276311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium917Open in IMG/M
3300031682|Ga0318560_10480651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300031713|Ga0318496_10665752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300031713|Ga0318496_10805715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300031719|Ga0306917_10377100All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300031719|Ga0306917_10424583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1040Open in IMG/M
3300031719|Ga0306917_10762555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031740|Ga0307468_100446188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1006Open in IMG/M
3300031747|Ga0318502_10939304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031748|Ga0318492_10531153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300031763|Ga0318537_10135392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales916Open in IMG/M
3300031764|Ga0318535_10404087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031770|Ga0318521_10357443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium866Open in IMG/M
3300031771|Ga0318546_10466061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium885Open in IMG/M
3300031777|Ga0318543_10085972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1336Open in IMG/M
3300031778|Ga0318498_10109257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300031779|Ga0318566_10465830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300031794|Ga0318503_10029070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1611Open in IMG/M
3300031795|Ga0318557_10578871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031796|Ga0318576_10571894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031798|Ga0318523_10490696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300031831|Ga0318564_10092028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1344Open in IMG/M
3300031833|Ga0310917_10583332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300031835|Ga0318517_10270942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300031845|Ga0318511_10384816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031880|Ga0318544_10244521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium694Open in IMG/M
3300031890|Ga0306925_10226202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2018Open in IMG/M
3300031890|Ga0306925_10965648Not Available871Open in IMG/M
3300031896|Ga0318551_10781293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300031910|Ga0306923_10087259All Organisms → cellular organisms → Bacteria → Proteobacteria3505Open in IMG/M
3300031912|Ga0306921_11473511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300031941|Ga0310912_11131793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300031946|Ga0310910_10280283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1308Open in IMG/M
3300031947|Ga0310909_10302140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1341Open in IMG/M
3300031947|Ga0310909_10632929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300031954|Ga0306926_10535727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1436Open in IMG/M
3300031954|Ga0306926_11182689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium899Open in IMG/M
3300031954|Ga0306926_11527201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium769Open in IMG/M
3300031959|Ga0318530_10301018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300031981|Ga0318531_10141538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1075Open in IMG/M
3300032025|Ga0318507_10435955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300032044|Ga0318558_10407064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300032051|Ga0318532_10265011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300032052|Ga0318506_10399791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300032068|Ga0318553_10160486Not Available1166Open in IMG/M
3300032076|Ga0306924_11522287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300032076|Ga0306924_12179985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300032076|Ga0306924_12409485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300032076|Ga0306924_12503859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300032076|Ga0306924_12630339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300032090|Ga0318518_10628931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300032094|Ga0318540_10343957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300032174|Ga0307470_11588733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300032261|Ga0306920_101357429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1020Open in IMG/M
3300032261|Ga0306920_101634542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium915Open in IMG/M
3300032261|Ga0306920_103379706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.89%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_062488013300000033SoilWIAAVTAYALALHVLLTGVAVGHAMPGGDASANSLSLICHSDGSSDPQDLPDNQPLVQSPCIFCTLAKAPCAILP
Ga0066388_10282415713300005332Tropical Forest SoilVWKRRKSATRMRPWIATVTAYALALQVLLTGVAAGHWMPGDNASGTSLFVICHGDGLSDGQDLPDKQPLA
Ga0008090_1569553513300005363Tropical Rainforest SoilLKRRNARSRMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASSLFVICHGNASSDDQDLPGKEPLARSPCMLCTLAKAPCAILPSDHG
Ga0008090_1588627513300005363Tropical Rainforest SoilMRPWIATVAAYALALQVLLTGVAAGHFMAAGDTSAISPFVICHGNGSPDDQDLPGKGPLARSPCILCTLAKTPCAILPTDHGVALSDAMGTSN
Ga0066903_10103359733300005764Tropical Forest SoilVLKGRNAGSRMRPWVATVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKAPLAQSPCMLCTLAKAPCAILPSDAAAPTRC*
Ga0075434_10160035813300006871Populus RhizosphereVFKRRNARNRMRPWIATVAAYALALQVLLTGVAAGHFMAAGDASASTLFVICHGNGSSDDQELPGKEPLAQSPCILCTLA
Ga0074063_1005086513300006953SoilLKRRNARNRMRPWIATVAAYALALQVLLTGMAAGHFMAAGDASASTLFVICHGNGSSDDHELPGKAPPARSSCILCTLAKAPCAILPTDHGIAVSDAMGTAN
Ga0066710_10442185213300009012Grasslands SoilVWTRRKSAKRMRPWIATLAAYALALHVLLTGVAAGHAMPGGNEPATSLFVICHGDGSSDGQDLPDKQPLAQSPCMFCTLAKATCAILPPDHGIVISRA
Ga0126373_1283110823300010048Tropical Forest SoilMRPWIATVAACALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQGLPGKAPLAQSPCMLCTLAKAPCAILPGDHGIVL
Ga0126378_1074485813300010361Tropical Forest SoilMRPWIATVAAYALALQVLLTGVAAGHFMAASDASASSPFVICHGNGSQGDQDLPGNEPLARSPCILCTLAKVPCAILPTSHGIAS*
Ga0126377_1085746523300010362Tropical Forest SoilMRPWIASVAAYALALQVLLTGVAAGHFMAASDASASSPFVICHGNGSQGDQDLPGNEPLARSPCILCTLAKVPCAILPTSHGIAS*
Ga0137383_1063968513300012199Vadose Zone SoilMRPWIATVAAYAIALPVVLTGVAAGPFMAAGDASASNLFVICHGNSSSDNQDLPGNEPLAQSPCVLCTLAKAPCAITMALRSAMQ*
Ga0137363_1077413413300012202Vadose Zone SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSLFVICHGNGSSDDQELPAKAPPAQSSCI
Ga0137376_1165397323300012208Vadose Zone SoilMRPWIATVAAYALALQILLAGVATGHFMAPGDASASGLFAICHGNGSSDNQDLPDKQPLAQSPCILCTLAKAPCAILPADQRIEISDAIGISNAAARSDG
Ga0137377_1152862923300012211Vadose Zone SoilMRPWIATVAAYALALQVLLTGVSAGHVMATGDASASTLFVICHGNSSSDDQELPAKEPLARSPCMLCTLAKAPCAILPSDHG
Ga0134110_1051109113300012975Grasslands SoilMRPWIARLAAYALALHVLLTGVAAGHAMPGGNEPASSLFVICHGDGSSDGQDLPDKQPLAQSPCMFCTLAKATCAILPPDH
Ga0164309_1175619623300012984SoilMRPWIATVAAYALALQVLLTGVAAGHVMAAGDASASSLFVICHGNGSSDDQELPGKAPPAQSSCILCTLAKTPCAILPTDQGMAVSDTMG
Ga0164308_1150184723300012985SoilMRPWIATVTAYALALQVLLTGVAVGHAMPSSIASATSLFVICHGDGSSAPQDLPDKQPVAQPPCIFCTLAKAPCAILPT
Ga0182036_1028563613300016270SoilVPKWCNARNRMRPWIASVAAYALAPQLLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKAPLARSPCIL
Ga0182036_1057397913300016270SoilLKWRNARNRMRPWIAAVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNSSSDDQDLPGKEPLARSPCMLCTL
Ga0182036_1142601023300016270SoilMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAVEQTAALSSSIRPRAST
Ga0182041_1109526513300016294SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTDHGIAVSDAMGT
Ga0182033_1021488413300016319SoilVLKRRNARSVMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPPVQSSCI
Ga0182033_1124062413300016319SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILCTLAKTPCAILPT
Ga0182033_1136535013300016319SoilVLKGRNAGSRMRPWIATVAAYALALQVLLTGVAAGHLMAAGDASASSLFVICHSNSSTNDQGLPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAVA
Ga0182035_1198413613300016341SoilVLKRRNARSVMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPPAQSSCILCTLAKAPCAI
Ga0182040_1080204113300016387SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPGKEPLAQSPCM
Ga0182039_1062978323300016422SoilVLKRRNARNRMRPWIATVAAYALALQVLLTGVAAGHLMAAGDASASSLFVICHSNSSTNDQGLPGKEPLARSPCMLCTLAKAPCAILPTDHGIAIRDAIGISKAVAR
Ga0182039_1076344433300016422SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTD
Ga0182038_1086311713300016445SoilVLKRRNARSVMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPP
Ga0182038_1193030013300016445SoilVPKWCNARNRMRPWIASVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQDLPGKAPLARSPCILCTLAKAPCAILPTDHGIAVSDAMGSSSAA
Ga0066655_1034546813300018431Grasslands SoilVWTRRKSAKRMRPWIARLAAYALALHVLLSGVAAGHAMPGGNEPATSLFVICHGDGSSDGQDLPEKQPLAQSPCMFCTLA
Ga0210406_1052270533300021168SoilVSKRRKARNRMRPWIATVAAYALALQVLLTGVAAGHFMAGDDASASSLFVICHGNGSSDDQELPGKAPPAQSSC
Ga0210408_1098781813300021178SoilLNRRNARNRMRPWIATVAAYALALQVLLTGVAAGHVMAAGDASASTLFVICHGNGSSDDQELPGKAPLARSPCILCTLAKAP
Ga0210384_1104500023300021432SoilVWKRRKSASRTRPWIATLTAYALALHVILTGVAAGHAMPDGNASGTGLFVICHGDGSSDRQDLPDKAPLAQSPCIFCTLAKASCAILPTDHGVVIGRAIGI
Ga0213879_1005294723300021439Bulk SoilVLKRRNVRNRMRPWIATVAAYALALQVLLTGVAAGHVMAAGDASASSLFVICHGNGSSDDQGLPGKAPLAQSPCMLCTLAKAPCAILPSDH
Ga0207685_1018018013300025905Corn, Switchgrass And Miscanthus RhizosphereVWKRRKSASRMRPWIATVTAYALALHVLLIGVAVGHAMPGGDASATSLFVICHGDGSSDPQDLPDNQPLVQSPCIFCTVAKTPCAILPIGHGVVISRAMGISNAA
Ga0137415_1026874413300028536Vadose Zone SoilVWKWRKAASRTRPWIAAVTAYALALQLLLTGVAAGHAMPGGSASGASLFVICHGDGSSDSQDLPGKQPLAQSPCIFCTLAKAPCAILPTGNGVVLSRAIGISSAALQSD
Ga0307282_1061859913300028784SoilMVAVYALALQVLLSGLAAGHFMAATDASAGDLFAICHGAGAASPDDQGLPDKQPLPQSPCVLCTLTKAP
Ga0307312_1025561123300028828SoilVWKRRKSASRMRPWIATVTAYALALHVLLTGVAAGNAMPGGDASATSLFVICHGDGSSDPQDLPDNQPLVQSPCIFCTSAKAPCAILPTGH
Ga0318534_1032601533300031544SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCIL
Ga0318541_1059589013300031545SoilVLKRRNARSVMRPWIATVAAYALALQVLLTGVAAGHFMAADDASANSLFVICHGNASADDQDLPGKEPLARSPCMLCTLAKAPCAILPSDHGVAVSDT
Ga0318528_1018176913300031561SoilMRPWIAAVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNSSSDDQDLPGKEPLARSPCMLCTLAKTPCAILPSDHGIALSDAMVISN
Ga0318528_1039116823300031561SoilVLKRRKAGSRMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPYAILP
Ga0318515_1043978813300031572SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTDHGIAVSDAMG
Ga0318515_1044312823300031572SoilVLKRRKAGSRMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPCAILPTGHGIA
Ga0318515_1052982513300031572SoilVLKRRNARNRMRPWIATIAAYALALQVLLTGVAAGHVMAAGDASASTLFVICHGNGSSDDQELPDKAPPAQSSCVLCTLAKAPCAILPTDHGM
Ga0318555_1037008623300031640SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTDHG
Ga0318555_1045845323300031640SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILC
Ga0318561_1027631113300031679SoilVLKRRNALSRMRPWIATVAAYALALQVLLTGVAAGHLMAAGDASASSLFVICHSNSSSDNQNLPDKEPLARSPCILCTLAKSAVCDRTD
Ga0318560_1048065113300031682SoilVLKRRNARNRMRPWIATVAAYALALQVLLTGVAAGHLMAAGDASASSLFVICHSNSSTNDQGLPGKEPLARSPCMLC
Ga0318496_1066575213300031713SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTDHGIAVSDA
Ga0318496_1080571523300031713SoilVLKRRNARNRMRPWIATVVAYALALQVLLTGMAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKEPLAQSSCILCTLAK
Ga0306917_1037710013300031719SoilLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILCTLAK
Ga0306917_1042458313300031719SoilVLKWRNARSRMRPWIAAVAAYALALQVLLTGVTAGHFVAAGDASASSLFVICHGNGSSDDQELPGNAPLAQSPCMLCTLAKAPCAILP
Ga0306917_1076255513300031719SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISD
Ga0307468_10044618813300031740Hardwood Forest SoilMRPWIATVTAYALALQVLLTGVAVGHAMPSSIASATSLFVICHGDGSSAPQDLPDKQPVAQPPCIFCTLAKAPCAILPTGHGLVTSRAMGISNAALQS
Ga0318502_1093930413300031747SoilMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHG
Ga0318492_1053115313300031748SoilLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCIL
Ga0318537_1013539213300031763SoilVLKRRKAGSRMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPYAILPTGHGIA
Ga0318535_1040408713300031764SoilVLKRRKAGSRMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPCAILPTGHGI
Ga0318521_1035744313300031770SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILCT
Ga0318546_1046606113300031771SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILCTLAKTPCAILPTDHGITVSDAIGTSN
Ga0318543_1008597223300031777SoilVPKWCNARNRMRPWIASVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQDLPGKEPLARS
Ga0318498_1010925723300031778SoilMRPWIASVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQDLPGKEPLARSPCMLCT
Ga0318566_1046583023300031779SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSS
Ga0318503_1002907013300031794SoilVLKRRNARNRMRPWIATVAACALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQDLPGKAPLARSPCILCTLAKAPCAILPTDHGIEVS
Ga0318557_1057887113300031795SoilVLKRRNARSVMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPPAQSSCILCTLAKAPCAILPTDHS
Ga0318576_1057189413300031796SoilVLKWRNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDASASSPFVICHGNSSPDDQDLPDKTPPAQSPCMLCTLAKAPC
Ga0318523_1049069613300031798SoilVLKRRNARNRMRPWIATVVAYALALQVLLTGMAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKEPLAQSSCILCTLAKVPCAILPSDHGIAVSN
Ga0318564_1009202813300031831SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDAAASSLFVICHGNSSSDDRDLPGKEPLARSPCILCTLAKTP
Ga0310917_1058333213300031833SoilVLKRRNARNRMRPWIATVAACALALQVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQDLPGKEPLARSP
Ga0318517_1027094213300031835SoilMRPWIATVAAYALALQVLLTGVAAGHLVAAGDASASSPFIICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPYAILPTGHGIAISDSI
Ga0318511_1038481613300031845SoilVLKRRNARNRMRPWIATVVAYALALQVLLTGMAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKEPLAQS
Ga0318544_1024452123300031880SoilLKRRKAGSRMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPYAILPTGHGIA
Ga0306925_1022620233300031890SoilVSKGCNAGNRMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAV
Ga0306925_1096564813300031890SoilVLKWRNARNRMRPWIASVAAYALALQVLLTGVAAGHFMAASDASASSPFVICHGNGSQDDQDLPGNEPLARSPCILCT
Ga0318551_1078129313300031896SoilVLKGRNARNRMRPWIATVAAYALALQVLLTGVAAGHFMAAGDGSASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPSEHGIAVSD
Ga0306923_1008725913300031910SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAP
Ga0306921_1060740123300031912SoilMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPPAESTETPKPDA
Ga0306921_1147351113300031912SoilVLGCGSVLKRRNARNRMRPWIATVAAYALALQVLLTGMAAGHFMAAGDASASTLFVICHGNGASDDQELPAKAPPAQSSCILCTLA
Ga0310912_1113179313300031941SoilVLKGRNAGSRMRPWIATVAAYALALQVLLTGVAAGHLVAAGDASASSPFIICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPYAILP
Ga0310910_1028028313300031946SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAVA
Ga0310909_1030214043300031947SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGI
Ga0310909_1063292913300031947SoilVLKRRNARSVMRPWIATVAAYALALRVLLTGVAAGHFMAAGDASASSLFVICHGNGSSDDQELPAKAPPAQSSCILCTLAKAPCAILPTDHSN
Ga0306926_1053572713300031954SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAVARTDG
Ga0306926_1118268913300031954SoilVSKGCNAGNRMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAISDAIGISKAVARTD
Ga0306926_1152720123300031954SoilVLKGRNAGSRMRPWIATVAAYALALQVLLTGVAAGHLVAAGDASASSPFIICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPYAILPTGHGIAISDSIGISKA
Ga0318530_1030101813300031959SoilLKWRNARNRMRPWIAAVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNSSSDDQDLPGKEPLARSPCMLCTLAKTPCAILPSDHGIALSDA
Ga0318531_1014153813300031981SoilVLKRCNARNRMRPWIAAVAAYALALQVLLTGVVAGHFMVAGDASASSLFVICHGNSSSDDQDLPGKEPLARSPCILCTLAKTPCAILPTDHGIAV
Ga0318507_1043595513300032025SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPV
Ga0318558_1040706413300032044SoilVLKRRKARNRMRPWIATVAAYALALQVLLTGVSAGHVMAAGDASASTLFVICHGNGSSDDQELPAKAPPVQSSCILCTLAKAPCAILPTDYGIAVSDAMGTAN
Ga0318532_1026501113300032051SoilVSKGCNAGNRMRPWIATVAAYALALQVLLTGVAAGHFMAADDASASTLFVICHGNGSSDDQELPGKEPLAQSPCMLCTLAKAPCAILPTGHGIAI
Ga0318506_1039979113300032052SoilLKWRNARNRMRPWIAAVAAYALALQVLLTGVAAGHFMAAGDASASSLFVICHGNSSSDDQDLPGKEPLARSPCMLCT
Ga0318553_1016048613300032068SoilVLKWRNARNRMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDASASSPFVICHGNSSPDDQDLPDKTPPAQSP
Ga0306924_1152228713300032076SoilMRPWIAAVAAYALALQVLLTGVTAGHFMAAGDASASSPFVICHGNSSPDDQDLPDKTPPAQSPCMLCTLAKAPCAILPTNHGIAIGDAIGISKAVA
Ga0306924_1217998523300032076SoilVSKRPNIGSRMRPWIAVVAAYALGLQVLLTGLAVGHSIGAGNGYDSGLFVVCHGDGSSDKQEVPGKEPLAGSPCVFCTLAKA
Ga0306924_1240948513300032076SoilVLKRRNARNRMRPWIATIAAYALALQVLLTGVAAGHVMAAGDASASTLFVICHGNGSSDDQELPDKAPPAQSSCVLCTLAKAPCAILP
Ga0306924_1250385913300032076SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCMLAKAPCAILPTGHGIAISDAIGISKAVEQTAALSSSI
Ga0306924_1263033913300032076SoilVLKRRNALNRMRPWIATVAAYALALQVLLTGVAAGHLMTAGDASASSLFVICHGNSSSDNQELPDKEPLARSPCILCTLAKAPCVILPTDHG
Ga0318518_1062893113300032090SoilVLKRRNARNRMRPWIATVVAYALALQVLLTGMAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKEPLAQSSCILCTLAKVPCAILPATMALRSAM
Ga0318540_1034395713300032094SoilVLKRRNARNRMRPWIATVVAYALALQVLLTGMAAGHFMAAGDASASSLFVICHGNGSSDDQELPGKEPLAQSSCILCTLAKVPCAILPSDHGIAVS
Ga0307470_1158873323300032174Hardwood Forest SoilVWKRGNVGSCLRPWIAMVAAYALALQVLLTGVAAGHAMSAADASGNGLFVVCHGDGSSDNQGLPDTEPPVRPPCIFCTLAKAPCAVLPTDHGIVISHAV
Ga0306920_10135742913300032261SoilMRPWIATVAAYALALQVLLTGMAAGHLMAAGDASASSPFVICHGNGSSDDQELPGKEPLAQSPCMLCTLA
Ga0306920_10163454223300032261SoilVLGCGSVLKRRNARNRMRPWIATVAAYALALQVLLTGMAAGHFMAAGDASASTLFVICHGNGASDDQELPAKAPPAQSSCILCTLAKAP
Ga0306920_10337970613300032261SoilLKGRNAGSRMRPWIATVAAYALALQVLLTGMAAGHFMAAGDASASSPFVICHGNGSSDDQELPGKEPLARSP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.