NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093364

Metagenome Family F093364

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093364
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 44 residues
Representative Sequence MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLK
Number of Associated Samples 93
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.57 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.623 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(13.207 % of family members)
Environment Ontology (ENVO) Unclassified
(18.868 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.453 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.19%    β-sheet: 0.00%    Coil/Unstructured: 60.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF07676PD40 4.72
PF00144Beta-lactamase 2.83
PF12543DUF3738 2.83
PF01850PIN 1.89
PF13378MR_MLE_C 1.89
PF09957VapB_antitoxin 0.94
PF01152Bac_globin 0.94
PF13561adh_short_C2 0.94
PF0563523S_rRNA_IVP 0.94
PF01569PAP2 0.94
PF01738DLH 0.94
PF15919HicB_lk_antitox 0.94
PF00027cNMP_binding 0.94
PF14870PSII_BNR 0.94
PF13620CarboxypepD_reg 0.94
PF13701DDE_Tnp_1_4 0.94
PF13714PEP_mutase 0.94
PF13515FUSC_2 0.94
PF08450SGL 0.94
PF02129Peptidase_S15 0.94
PF13414TPR_11 0.94
PF13692Glyco_trans_1_4 0.94
PF01381HTH_3 0.94
PF13384HTH_23 0.94
PF01261AP_endonuc_2 0.94
PF09876DUF2103 0.94
PF00069Pkinase 0.94
PF02518HATPase_c 0.94
PF13442Cytochrome_CBB3 0.94
PF05724TPMT 0.94
PF06283ThuA 0.94
PF07366SnoaL 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.77
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 2.83
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 2.83
COG2367Beta-lactamase class ADefense mechanisms [V] 2.83
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.94
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.94
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.94
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.62 %
UnclassifiedrootN/A10.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_101016600All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005327|Ga0070658_10875589All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis781Open in IMG/M
3300005344|Ga0070661_100547420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55931Open in IMG/M
3300005435|Ga0070714_100420135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1266Open in IMG/M
3300005535|Ga0070684_100645043All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300005764|Ga0066903_100884271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1614Open in IMG/M
3300005764|Ga0066903_103966302Not Available794Open in IMG/M
3300005921|Ga0070766_11174375All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300006028|Ga0070717_11278300All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300006052|Ga0075029_100001913All Organisms → cellular organisms → Bacteria11842Open in IMG/M
3300006052|Ga0075029_100026000All Organisms → cellular organisms → Bacteria3301Open in IMG/M
3300006162|Ga0075030_100919585All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300006954|Ga0079219_10940511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300009093|Ga0105240_10502920All Organisms → cellular organisms → Bacteria → Acidobacteria1347Open in IMG/M
3300009177|Ga0105248_11866758All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300009521|Ga0116222_1085293All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300009700|Ga0116217_10006542All Organisms → cellular organisms → Bacteria10096Open in IMG/M
3300010048|Ga0126373_10495539All Organisms → cellular organisms → Bacteria → Acidobacteria1263Open in IMG/M
3300010358|Ga0126370_10841245All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300010373|Ga0134128_10789130All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300010379|Ga0136449_101508244All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300010398|Ga0126383_11965786All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010398|Ga0126383_12439813All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300012354|Ga0137366_11223606All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300012924|Ga0137413_10313763All Organisms → cellular organisms → Bacteria → Acidobacteria1100Open in IMG/M
3300012958|Ga0164299_11006882Not Available614Open in IMG/M
3300012971|Ga0126369_12848310Not Available566Open in IMG/M
3300012988|Ga0164306_11083078All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300013105|Ga0157369_10233893All Organisms → cellular organisms → Bacteria → Acidobacteria1921Open in IMG/M
3300014152|Ga0181533_1179775All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300014199|Ga0181535_10319655Not Available922Open in IMG/M
3300014489|Ga0182018_10293363Not Available886Open in IMG/M
3300014489|Ga0182018_10611093All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300014492|Ga0182013_10005472All Organisms → cellular organisms → Bacteria14755Open in IMG/M
3300014496|Ga0182011_10871511All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300014501|Ga0182024_10763347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea1184Open in IMG/M
3300014502|Ga0182021_11188992All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300014638|Ga0181536_10208399All Organisms → cellular organisms → Bacteria → Acidobacteria967Open in IMG/M
3300014839|Ga0182027_11368645All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300015371|Ga0132258_13590783All Organisms → cellular organisms → Bacteria → Acidobacteria1061Open in IMG/M
3300015373|Ga0132257_100995026Not Available1055Open in IMG/M
3300016387|Ga0182040_11796724All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300017940|Ga0187853_10142381All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300017996|Ga0187891_1201730Not Available679Open in IMG/M
3300018019|Ga0187874_10250708All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300018026|Ga0187857_10269050Not Available782Open in IMG/M
3300018033|Ga0187867_10816465All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300018037|Ga0187883_10559951All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300018060|Ga0187765_10749836All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300019082|Ga0187852_1109207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1209Open in IMG/M
3300019082|Ga0187852_1179006All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300020579|Ga0210407_10656502All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300021401|Ga0210393_10188766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1664Open in IMG/M
3300021403|Ga0210397_10782871All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300021405|Ga0210387_11387948All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300025898|Ga0207692_10690958All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300025909|Ga0207705_10684320All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300025913|Ga0207695_11344522All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300025921|Ga0207652_11890282All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300025928|Ga0207700_11962515All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300025929|Ga0207664_10172322All Organisms → cellular organisms → Bacteria → Acidobacteria1853Open in IMG/M
3300027911|Ga0209698_10777257All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300028747|Ga0302219_10258258All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300028775|Ga0302231_10526084All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300028798|Ga0302222_10155100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae902Open in IMG/M
3300029910|Ga0311369_10495087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1040Open in IMG/M
3300029910|Ga0311369_11165353All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300029913|Ga0311362_10438369All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300029922|Ga0311363_10961448Not Available756Open in IMG/M
3300029951|Ga0311371_11802952All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300030007|Ga0311338_10102610All Organisms → cellular organisms → Bacteria → Acidobacteria3551Open in IMG/M
3300030057|Ga0302176_10377703All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300030399|Ga0311353_10351628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1337Open in IMG/M
3300030737|Ga0302310_10311249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae883Open in IMG/M
3300031028|Ga0302180_10255744All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300031231|Ga0170824_109706523All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300031234|Ga0302325_11764456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales778Open in IMG/M
3300031525|Ga0302326_10132906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4336Open in IMG/M
3300031525|Ga0302326_10896943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis1261Open in IMG/M
3300031708|Ga0310686_118715225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni1407Open in IMG/M
3300031708|Ga0310686_119151302All Organisms → cellular organisms → Bacteria3150Open in IMG/M
3300031902|Ga0302322_102771005All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300031912|Ga0306921_11677584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300031938|Ga0308175_100135276All Organisms → cellular organisms → Bacteria → Acidobacteria2339Open in IMG/M
3300031938|Ga0308175_102960251All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300031939|Ga0308174_10336521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1200Open in IMG/M
3300031954|Ga0306926_12967293Not Available508Open in IMG/M
3300031962|Ga0307479_12063974All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300031996|Ga0308176_12643293All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300032076|Ga0306924_11569885All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300032076|Ga0306924_11647886All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300032160|Ga0311301_10855907All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300032160|Ga0311301_11678863All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300032261|Ga0306920_103240210All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300032829|Ga0335070_11139995Not Available717Open in IMG/M
3300032895|Ga0335074_11153561All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300032897|Ga0335071_10167618All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300033004|Ga0335084_10940824All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300033405|Ga0326727_10288268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1635Open in IMG/M
3300033493|Ga0316631_10181855All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300033513|Ga0316628_104361655All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300033755|Ga0371489_0002268All Organisms → cellular organisms → Bacteria26038Open in IMG/M
3300033824|Ga0334840_064950All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300033824|Ga0334840_142175All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300034163|Ga0370515_0051013All Organisms → cellular organisms → Bacteria → Proteobacteria1823Open in IMG/M
3300034163|Ga0370515_0398293All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.21%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.72%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.77%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.89%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.94%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10101660013300004092Bog Forest SoilMPTDENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNS
Ga0070658_1087558913300005327Corn RhizosphereMSTRENAIRRRSFLSMGATAAGLGLLSDLEAYPQNVNRNS
Ga0070661_10054742013300005344Corn RhizosphereMSANKNAIGRRSFLRTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKI
Ga0070714_10042013513300005435Agricultural SoilMSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRNS
Ga0070684_10064504313300005535Corn RhizosphereMSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSNPS
Ga0066903_10088427113300005764Tropical Forest SoilMATKDNEIGRRLLLGTGAAAAGLGLLADLEAYPQNVNRSSSPSDLKITDMRIAV
Ga0066903_10396630213300005764Tropical Forest SoilMSTKENEIGRRSLLSKGAAAAGLGLLADLEAYPQNVN
Ga0070766_1117437523300005921SoilMSKEENAIGRRALLGTGAAVAGLGLLADLDAYPQNVNRNSIPSDLKV
Ga0070717_1127830013300006028Corn, Switchgrass And Miscanthus RhizosphereMSSTNHLGRRSFLKMGGVAASLGILDDLEAYPQNVNRNSKPSDLK
Ga0075029_10000191313300006052WatershedsMASKQSLFGRRSFLKKGGMAAGLGLLADLEAYPQNVNRNS
Ga0075029_10002600053300006052WatershedsMSKEENAIGRRALLGTGAAVAGLGLLADLEAYPQNVNRNSIP
Ga0075030_10091958513300006162WatershedsMSTKENAIGRRSLLSMGAAAAGLGLLADLEAYPQNVNRNSIPSDLKITDMR
Ga0079219_1094051123300006954Agricultural SoilMSSKNLFGRRSFLKKGGMAAGLGLLADLEAYPQNVNRNSKP
Ga0105240_1050292013300009093Corn RhizosphereMFTKGNTIGRRSFLGMGAAAALGLWADLEAYPQNVNRNSSPSDLKITDM
Ga0105248_1186675823300009177Switchgrass RhizosphereMSSNESFFGRRSFLKKGGMAAGIGLFADLEAYPQNVNRNS
Ga0116222_108529333300009521Peatlands SoilMSTKENAIGRRLLLGTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIA
Ga0116217_1000654213300009700Peatlands SoilMSIEENAIGRRSLLRRGATAAGLGLLADLEAYPQNVNRNSLPSDLKVTDMRIAV
Ga0126373_1049553913300010048Tropical Forest SoilMSKEENAIGRRAFLSTGAAVAGLGLLADLEAYPQNVNRNSLPSDLKITD
Ga0126370_1084124523300010358Tropical Forest SoilMSTKENEIGRRSLLSKGAAAAGLGLLADLEAYPQNVNRNS
Ga0134128_1078913013300010373Terrestrial SoilMSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSSPSDLK
Ga0136449_10150824433300010379Peatlands SoilMTSKNNLFGRRSFLKTGGMAAGLGLLTDLEAYPQNVNRNSKPSDLKIT
Ga0126383_1196578613300010398Tropical Forest SoilMSKEENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIA
Ga0126383_1243981313300010398Tropical Forest SoilMSTKENAIGRRALLGTGAAAAGLGLLADLDAYPQNVNRNSIPSDLKVTDMR
Ga0137366_1122360613300012354Vadose Zone SoilMSSKNNLVGRRSFLKTGGMAAGLGLFTDLEAYPQNVNRNSKPSDLK
Ga0137413_1031376313300012924Vadose Zone SoilMSTKIGRRSFLSMGAAAAGLGLFADLEAYPQNVNRNSIAS
Ga0164299_1100688223300012958SoilMSTDENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNR
Ga0126369_1284831013300012971Tropical Forest SoilMSKEENAIGRRALLGTGAAVAGLGLLADLEAYPQNVN
Ga0164306_1108307823300012988SoilMSRNENGIGRRSLLKRGAAALGLGLLADLEAYPQNVNRKSSPSDLKIT
Ga0157369_1023389313300013105Corn RhizosphereMSKDENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRSSIPSDLKITDMRIAV
Ga0181533_117977513300014152BogMSTKENAIGRRSLLSTGAAAAGLGLLADLDAYPQNVNRNSIPSDLKVT
Ga0181535_1031965523300014199BogMSTNENAIGRRALLGTGAAVAGLGLLADLEAYPQNV
Ga0182018_1029336323300014489PalsaMSTKGSTIGRRKFLGMGAAAAGLGLWADLEAYPQNVN
Ga0182018_1061109313300014489PalsaMSTKIGRRSFLSMGAAAAGIGLLADLEAYPQNVNRNSIPSDLKITDMRI
Ga0182013_10005472123300014492BogMSTKENAIGRRALLGTGAAVAGLGLLADLEAYPQNV
Ga0182011_1087151113300014496FenMSKEENAFGRRSLLMAGATAAGLGLLADVEAYPQNVNRNSLPSDLKVTD
Ga0182024_1076334723300014501PermafrostMSTKNAVGRRSFLKMGAAAAGLGLWADLEAYPQNV
Ga0182021_1118899213300014502FenMSIEENAIGRRSLLRSGATAAGLGLLADLEAYPQNVNRN
Ga0181536_1020839923300014638BogMFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMR
Ga0182027_1136864513300014839FenMSTNENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMR
Ga0132258_1359078313300015371Arabidopsis RhizosphereMSTDENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNRSSSPSDLKIT
Ga0132257_10099502613300015373Arabidopsis RhizosphereMSTNENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNRN
Ga0182040_1179672423300016387SoilMSKEENAIGRRALLSTGAAVAGLGLSADLEAYPQNVNRNSIPSDLKITDMR
Ga0187853_1014238113300017940PeatlandMFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQN
Ga0187891_120173023300017996PeatlandMSSKEDLLGRRSFLTKGGMVAGAGLLADLEAYPQNVNRNSQPSDLKITDM
Ga0187874_1025070813300018019PeatlandMSTKENTIGRRSLLTTGAAAAGLGLLADLEAYPQNVNR
Ga0187857_1026905013300018026PeatlandMSIDENAIGRRSLLRRGATAAGLGLLADLEAYPQN
Ga0187867_1081646523300018033PeatlandMATNENTIGRRSLLTTGAAAAGLGLLADLEAYPQNVNRNSIPSDLRV
Ga0187883_1055995123300018037PeatlandMSTKENAIGRRALLGTGAAVAGLGLLADLEAYPQDVNRNSIPSDLKV
Ga0187765_1074983613300018060Tropical PeatlandMSKEENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNSIPSDLK
Ga0187852_110920723300019082PeatlandMSSKEDLLGRRSFLKTGGMAAGVGILGELEAYPQNVNRNSQP
Ga0187852_117900633300019082PeatlandMFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDL
Ga0210407_1065650213300020579SoilMSTKENAIGRRSLLSTGAAVAGLGLLTDLEAYPQDVNRNSIPSDLKIT
Ga0210393_1018876633300021401SoilMSIKIGRRSFLGMGAAAAGLGLWADLEAYPQNVNRNSIA
Ga0210397_1078287113300021403SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNR
Ga0210387_1138794813300021405SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQDVNRNSIPSDLKV
Ga0207692_1069095823300025898Corn, Switchgrass And Miscanthus RhizosphereMSSKNNLFGRRSFLKTGGMAAGLGLFTDLEAYPQNVNRNSKPSDLKI
Ga0207705_1068432013300025909Corn RhizosphereMSTRENAIRRRSFLSMGATAAGLGLLSDLEAYPQNVNRNSIPSDL
Ga0207695_1134452213300025913Corn RhizosphereMFTKGNTIGRRSFLGMGAAAALGLWADLEAYPQNVNRNSIASDLKITDV
Ga0207652_1189028223300025921Corn RhizosphereMSKSENAIGRRSLLRMGAAAPGLGLLADLEAYPQNVNRNSSPSDLKIT
Ga0207700_1196251513300025928Corn, Switchgrass And Miscanthus RhizosphereMSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRNSSPSDLKI
Ga0207664_1017232213300025929Agricultural SoilMSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRN
Ga0209698_1077725733300027911WatershedsMSTKENAIGRRSLLSMGAAAAGLGLLADLEAYPQNVNRNSIPSD
Ga0302219_1025825813300028747PalsaMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNTNSRPSD
Ga0302231_1052608423300028775PalsaMSKKIGRRKFLGMGASAAGFGLLADLEAYPQNVNRNSIPSDLKITD
Ga0302222_1015510023300028798PalsaMSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDL
Ga0311369_1049508723300029910PalsaMSTKIGRRSFLSLGAAAAGLGLFADLEAYPQNVNRNS
Ga0311369_1116535313300029910PalsaMSRKIGRRSFLGMGAGVAGLGLLADLEAYPQNVNRNSIASDLKITD
Ga0311362_1043836913300029913BogMSTKENAIGRRSLLSSGAAAAGLGLLADLEAYPQDVNRNSIPSDLKVTDMRIA
Ga0311363_1096144823300029922FenMSTKENAIGRRSLLSTGAAAAGLGLLADLDAYPQNTNTNSRPSDLRVT
Ga0311371_1180295213300029951PalsaMSTKIGRRSFLSLGAATAGLGLFADLEAYPQNVNRNSIASD
Ga0311338_1010261053300030007PalsaMSTKIGRRKFLGMGAAAAGLGLWADLEAYPQSVNRNSIPSDLKITDMRIAVLR
Ga0302176_1037770323300030057PalsaMSTKIGRRSFLSMGAAAAGLGLLADLDAYPQNVNRNSIPSD
Ga0311353_1035162833300030399PalsaMSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDLKI
Ga0302310_1031124923300030737PalsaMSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDLK
Ga0302180_1025574433300031028PalsaMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNTNSRPSDLKI
Ga0170824_10970652313300031231Forest SoilMSTKKNVIGRRKFLGMGAAAAGFGLFADLEAYPQNVKRNSI
Ga0302325_1176445633300031234PalsaMSKKGTIGRRKFLGMGAAAAGLGLWGDLEAYPQNVNRNSIASDLKITD
Ga0302326_1013290613300031525PalsaMSTQGNKIGRRSFLKMGAATAGLGLWADLEAYPQNVNRNSI
Ga0302326_1089694313300031525PalsaMSTKIGRRKFLGMGAAAAGLGLWADLEAYPQNVNRNSIASDLKI
Ga0310686_11871522513300031708SoilMSKKIGRRSFLGMGAAVAGLGLWADLEAYPQNVNRNSI
Ga0310686_11915130233300031708SoilMSTKNAIGRRKFLGMGAAAAGLGFLADLEAYPQNVNR
Ga0302322_10277100523300031902FenMSIDENAIGRRSLLRKGATAAGLGLLADLEAYPQNVNRNSL
Ga0306921_1167758423300031912SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSMPSDLKITD
Ga0308175_10013527613300031938SoilMFRDENGIGRRSLLKTGAAAVGLGLWADLEAYPQNVNRNSSPSDLKITD
Ga0308175_10296025123300031938SoilMSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSSPSDLKITD
Ga0308174_1033652113300031939SoilMSTNENAIGRRALLGTGAAVAGLGLLADIEAYPQNVNRNSKPSDL
Ga0306926_1296729313300031954SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVN
Ga0307479_1206397413300031962Hardwood Forest SoilMSTKIGRRKFLGMGAAAAGLGLLADLEAYPQNVNRNSIASDLKITDM
Ga0308176_1264329323300031996SoilMSTNENAIGRRSLLGTGAAAAGLALLADLEAYPQNVNRNSTPSDLKITDM
Ga0306924_1156988513300032076SoilMSKEENAIGRRALLSTGAAVAGLGLLADLEAYPQNVNRNSIPSDLKITDMRI
Ga0306924_1164788613300032076SoilMNGKTIGRRSFLGMGAAAAGLGLWADLEAYPQNVN
Ga0311301_1085590713300032160Peatlands SoilMSSKNNLFGRRSFLKTGGMAAGLDLFTDLEANPQNVNRN
Ga0311301_1167886323300032160Peatlands SoilMSKEENAIGRRALLGTGAAVAGLGLLADLDAYPQNVNRNSIPSDLKVTDMRIAVLR
Ga0306920_10324021013300032261SoilMPSNNKLFGRRSFLKAGGVAAGLCLFDDMEAYLQNVNRNSIPSDLKITDMRIA
Ga0335070_1113999523300032829SoilMSTNENALGRRALLGTGAAVAGLGLLADLEAYPQNVN
Ga0335074_1115356113300032895SoilMSTNENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSS
Ga0335071_1016761813300032897SoilMSKEENAIGRRALLSTGAAVAGLGLLADLDAYPQNV
Ga0335084_1094082423300033004SoilMSTKEDAIGRRTLLTTGAAVAGLGLLADLDAYPQNV
Ga0326727_1028826843300033405Peat SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKV
Ga0316631_1018185513300033493SoilMSINGRALGRRSFLKRGAAAAGLGLFADLEAYPQNVNRNS
Ga0316628_10436165513300033513SoilMFTKEKSFGRRSFLTKGITAAGLGLFADLEAYPQNVNRNSKP
Ga0371489_0002268_25899_260363300033755Peat SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLK
Ga0334840_064950_2_1513300033824SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKVTDM
Ga0334840_142175_493_6363300033824SoilMSTKENAIGRRALLGTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKVT
Ga0370515_0051013_3_1523300034163Untreated Peat SoilMSTKGRIGRRKFLGMGAAAAGLGLWADLEAYPQNVNRNSIASDLKITDMR
Ga0370515_0398293_420_5813300034163Untreated Peat SoilMSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.