| Basic Information | |
|---|---|
| Family ID | F092905 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.86 % |
| % of genes near scaffold ends (potentially truncated) | 3.74 % |
| % of genes from short scaffolds (< 2000 bps) | 4.67 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.458 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.140 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00582 | Usp | 14.95 |
| PF00034 | Cytochrom_C | 13.08 |
| PF13442 | Cytochrome_CBB3 | 2.80 |
| PF00702 | Hydrolase | 2.80 |
| PF07884 | VKOR | 1.87 |
| PF13667 | ThiC-associated | 1.87 |
| PF12551 | PHBC_N | 0.93 |
| PF07731 | Cu-oxidase_2 | 0.93 |
| PF02705 | K_trans | 0.93 |
| PF04964 | Flp_Fap | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF00873 | ACR_tran | 0.93 |
| PF01977 | UbiD | 0.93 |
| PF02900 | LigB | 0.93 |
| PF07732 | Cu-oxidase_3 | 0.93 |
| PF05940 | NnrS | 0.93 |
| PF10116 | Host_attach | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.87 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 1.87 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.93 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3213 | Nitric oxide response protein NnrS | Signal transduction mechanisms [T] | 0.93 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.46 % |
| All Organisms | root | All Organisms | 6.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005172|Ga0066683_10408156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 838 | Open in IMG/M |
| 3300005764|Ga0066903_100021244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6929 | Open in IMG/M |
| 3300005764|Ga0066903_100487153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2082 | Open in IMG/M |
| 3300016387|Ga0182040_10186736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1512 | Open in IMG/M |
| 3300031945|Ga0310913_11192401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 530 | Open in IMG/M |
| 3300032076|Ga0306924_12300488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 546 | Open in IMG/M |
| 3300032261|Ga0306920_103645870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 566 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0173.00004440 | 2166559005 | Simulated | QRPLTSPPSIMAPKAIKESYMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLIR |
| AF_2010_repII_A1DRAFT_100239673 | 3300000597 | Forest Soil | MPVDTIVVVVMAAAFGIFAATLYWADLRTRGLTR* |
| AF_2010_repII_A1DRAFT_101137482 | 3300000597 | Forest Soil | MPIDTIVVVLMATAFGIFAATLYWADLRTRGLTR* |
| AF_2010_repII_A001DRAFT_101135831 | 3300000793 | Forest Soil | KQREPPMPTDTIVVFIMATAFGIFAATLYWADLRTRGVSS* |
| AP72_2010_repI_A100DRAFT_10009577 | 3300000837 | Forest Soil | MPTDTIVVLIMAAAFGIFAATLYWADLRTRGASS* |
| JGI10216J12902_1031653262 | 3300000956 | Soil | MPTDIVVLALIAAAFGAFAATLYWADLHTREVSK* |
| F14TB_1002552192 | 3300001431 | Soil | MPTEIIVVALIAAAFGIFAATLYWADLHTRGLSR* |
| JGI25617J43924_103446462 | 3300002914 | Grasslands Soil | MAPQRDKESFMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| JGI25616J43925_100168481 | 3300002917 | Grasslands Soil | PLTAAPSIMAPQRDKESFMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0066398_101494591 | 3300004268 | Tropical Forest Soil | EERRESFMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK* |
| Ga0066683_104081561 | 3300005172 | Soil | MAPERRESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRGLIR* |
| Ga0066388_1020725601 | 3300005332 | Tropical Forest Soil | LPKQREPPMPTDTIVVLIMATAFGIFAATLYWADLRTRGVSS* |
| Ga0066388_1085185361 | 3300005332 | Tropical Forest Soil | MLPCRERREPLMPTDIIVVALIAAAFGIFAATLYWADLHTGGLSK* |
| Ga0070697_1004706491 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDKESYMPIDPIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0066701_101911613 | 3300005552 | Soil | MPIDTIVVVLMAAAFGIFAATLYWADLRTRGLIR* |
| Ga0066661_100611543 | 3300005554 | Soil | MPVDTIVVVLMAAAFGIFAATLYWADLRTRELTR* |
| Ga0066692_103313922 | 3300005555 | Soil | MAPQSDKESYMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLIR* |
| Ga0066905_1001763682 | 3300005713 | Tropical Forest Soil | MPTDTIVVLVMASAFGIFAATLYWADLRTRGVSK* |
| Ga0066905_1006205712 | 3300005713 | Tropical Forest Soil | MPKDIIVVALIAAAFGIFAATLYWADLHTGGLSK* |
| Ga0066903_1000212442 | 3300005764 | Tropical Forest Soil | MTTDTIVVLTIAMAFGIFAGTLYWADLHTRPLNK* |
| Ga0066903_1002721313 | 3300005764 | Tropical Forest Soil | MPTDTIVVMVMAIAFGVFAGTLYWADLHTRALPK* |
| Ga0066903_1003263065 | 3300005764 | Tropical Forest Soil | MPTDTIVVLAMASAFGIFAATLYWAGLRTRGVSN* |
| Ga0066903_1004871534 | 3300005764 | Tropical Forest Soil | MPTDIIVVALIAAAFGIFAATLYWADLHTGGLSK* |
| Ga0066903_1005834281 | 3300005764 | Tropical Forest Soil | MSTDVIVVIAMALAFGAFAATLYWAHDQTRGLNG* |
| Ga0066903_1006573722 | 3300005764 | Tropical Forest Soil | MPMDTIVVVVMAAAFGIFAATLYWADLRTRGLSR* |
| Ga0066903_1007324933 | 3300005764 | Tropical Forest Soil | MPIDIIVVALIAAAFGIFAATLYWADLRTRGLSK* |
| Ga0066903_1010306943 | 3300005764 | Tropical Forest Soil | MQTDIIVVALIAAAFGTFAATLYWADLHTGGLSK* |
| Ga0066903_1010860471 | 3300005764 | Tropical Forest Soil | ENRGSRLMPTDIIVVALIAAAFGIFAATLYWADLHTGGLSK* |
| Ga0066903_1012553412 | 3300005764 | Tropical Forest Soil | MPVDTIVAVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0066903_1072519672 | 3300005764 | Tropical Forest Soil | MALEKQREPPMPTDTIVVLAMAAAFGIFAATLYWADLRTRGVSR* |
| Ga0066903_1090644622 | 3300005764 | Tropical Forest Soil | MPIDTIVAVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0081455_100428843 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSTEIIVATLIAAAFGIFAATLFWADLHTREPSK* |
| Ga0070717_100129112 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0099830_100290763 | 3300009088 | Vadose Zone Soil | MPIDTLVVALMALAFGAFAATLYWADRQTRGLSR* |
| Ga0099827_101469341 | 3300009090 | Vadose Zone Soil | MQTDVIVAVLMAAALGAFAATLYWADIHTRGLNK* |
| Ga0075423_107643482 | 3300009162 | Populus Rhizosphere | MPVDTIVVVLMAAAFGIFAATLYWADLHTRGLTR* |
| Ga0105104_103370801 | 3300009168 | Freshwater Sediment | MSLDIIVATVIASGFGIFAATLFWADVHTGGLRK* |
| Ga0126384_105837992 | 3300010046 | Tropical Forest Soil | MPVDTIVVVLIAAAFGIFAATLYWADLRTRGLTR* |
| Ga0126384_112155891 | 3300010046 | Tropical Forest Soil | MPVDTIVVVLMAAAFGIFAATLYWADLRTRRLTR* |
| Ga0126382_111534261 | 3300010047 | Tropical Forest Soil | SMPVDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0074046_100311145 | 3300010339 | Bog Forest Soil | MDVILVVAMVVAFGIFAITLAWADLRTRGLSDQH* |
| Ga0126370_105721003 | 3300010358 | Tropical Forest Soil | PKQREPPMPTDTIVVLIMAAAFGIFAATLYWADLRTRGASS* |
| Ga0126370_122413471 | 3300010358 | Tropical Forest Soil | MPIDTLVVALMALAFGAFAATLYWADRQTRGLSG* |
| Ga0126376_100367883 | 3300010359 | Tropical Forest Soil | MPTEIIVIALITAAFGAFAATLCWVDLHTREPSK* |
| Ga0126376_113570331 | 3300010359 | Tropical Forest Soil | MPTDIIVVALIAAAFGIFAATLYRADLHTGGLSK* |
| Ga0126372_101610323 | 3300010360 | Tropical Forest Soil | MPSEIIVVALITAAFGAFAATLFWVDLRTRELSK* |
| Ga0126372_114045541 | 3300010360 | Tropical Forest Soil | MPTDTIVVLIMATAFGIFAATLYWADLRTRGVSS* |
| Ga0126378_104500163 | 3300010361 | Tropical Forest Soil | MPTDIIVVALIAAAFGIFAATLYWADLHTGRLSK* |
| Ga0126383_104118172 | 3300010398 | Tropical Forest Soil | MPVDTIVVVLIAAAFGIFAATLYWADLRTRGLTRQ* |
| Ga0120191_100203471 | 3300012022 | Terrestrial | MPTEIIVAALIAAAFGIFAATLYWADLHTRGLSR* |
| Ga0153974_11161442 | 3300012180 | Attine Ant Fungus Gardens | MPIDTIVVVLMAAAFGIFAATLYWADLRTRGLAR* |
| Ga0137388_100052684 | 3300012189 | Vadose Zone Soil | MPIDTLVVALMTLAFGAFAAALYWADRQTRGLSR* |
| Ga0137383_101876201 | 3300012199 | Vadose Zone Soil | PSIMAPQIDKESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0137365_100412105 | 3300012201 | Vadose Zone Soil | MPIEIIAVALIAAAFGIFAATLYWADLHTRGLSK* |
| Ga0137365_107021492 | 3300012201 | Vadose Zone Soil | MPTDTIVVLIMAIAFGIFAGTLYWADLHTRPLSK* |
| Ga0137363_106331171 | 3300012202 | Vadose Zone Soil | MTTQIVVVAFIAVAFGIFAATLYWADLHTGGLSK* |
| Ga0137374_100743672 | 3300012204 | Vadose Zone Soil | MPTEIIVVALIAAAFGIFAATLYWADLRTRGLSR* |
| Ga0137376_103541572 | 3300012208 | Vadose Zone Soil | MPVDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0137379_102405591 | 3300012209 | Vadose Zone Soil | MPVDMIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0137378_109648631 | 3300012210 | Vadose Zone Soil | MMAPEERRESFMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK* |
| Ga0137377_105697282 | 3300012211 | Vadose Zone Soil | MPVDTIVVVLMAAAFGIFAATLYWADLRTRGLIR* |
| Ga0137371_101339712 | 3300012356 | Vadose Zone Soil | MPIEIIAVALIAAAFGIFAATLYWADLYTRGLSK* |
| Ga0137384_103964211 | 3300012357 | Vadose Zone Soil | MPIDTIVVVLMAAAFGIFAATLYWADLCTRGLTR* |
| Ga0137384_112768481 | 3300012357 | Vadose Zone Soil | MPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK* |
| Ga0137360_100333931 | 3300012361 | Vadose Zone Soil | SIMAPQSDKESYMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0137361_102379202 | 3300012362 | Vadose Zone Soil | MPTEIIVVALIAAAFGIFAATLYWADLHTGGLSK* |
| Ga0126369_101083406 | 3300012971 | Tropical Forest Soil | MPVDTIIVVLMPAAFGIFAATLYWADQRTRGLTR* |
| Ga0126369_101321802 | 3300012971 | Tropical Forest Soil | MSTEVIVVIAMALAFGAFAATLYWADHQTRGLNG* |
| Ga0164304_107025762 | 3300012986 | Soil | MLIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR* |
| Ga0182041_106372243 | 3300016294 | Soil | APEERRESFMPTDTIVVLAMASAFGIFAATLYWAGLRTRGVSK |
| Ga0182035_108949141 | 3300016341 | Soil | HQAGSNHMPIDVIVISLMTAAFVAFAATLYWADHRTRGLS |
| Ga0182040_101867361 | 3300016387 | Soil | NRGSRLMPKDIIVVALLAAAFGIFAATLYWADLHTGGLSK |
| Ga0182040_116202501 | 3300016387 | Soil | GGHLMPMELIVVSLMAAAFCIFAATLYWADLQTRNLH |
| Ga0182039_105810263 | 3300016422 | Soil | GSRLMPTDIIVVALIAAAFGIFAATLYWADLHTGGLSK |
| Ga0182038_114472792 | 3300016445 | Soil | MAPPERRESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Ga0066662_116207961 | 3300018468 | Grasslands Soil | MAPQSDKESYMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Ga0207646_113182372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDKESYMPIDPIVVVLMAAAFGIFAATLYWADLRTRGLIR |
| Ga0209465_103004702 | 3300027874 | Tropical Forest Soil | EAGRESFMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318516_100001791 | 3300031543 | Soil | EPPMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318538_100609454 | 3300031546 | Soil | MMAPEKRREPPMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318528_103458453 | 3300031561 | Soil | APPERRESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRRLTR |
| Ga0318515_105891552 | 3300031572 | Soil | MAPQSDKESFMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Ga0318560_100992664 | 3300031682 | Soil | RREPPMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0306917_113621871 | 3300031719 | Soil | SGRQSGSKPMPIELIAVSLMMAAFVAFAATLYWADHRTRGLR |
| Ga0318493_107230362 | 3300031723 | Soil | PLMPTDIIVVALIAAAFGIFAATLYWADLHTGGLSK |
| Ga0306918_107788121 | 3300031744 | Soil | GSHPMPTEIIVVALIAAAFGIFAATLYWADLHTGGLSK |
| Ga0318537_100082485 | 3300031763 | Soil | PMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318535_101696831 | 3300031764 | Soil | SIMAPPERRESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Ga0318521_101254154 | 3300031770 | Soil | PPMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318546_111341451 | 3300031771 | Soil | NRGSRLMPTDINVVALIAGIFAATLYWADLHTGKLSK |
| Ga0318543_100393571 | 3300031777 | Soil | SFMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318543_104243471 | 3300031777 | Soil | PMPTEIIVVALIAAAFGIFAATLYWADLHTGGLSK |
| Ga0318511_1000049710 | 3300031845 | Soil | ESFMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318511_101443143 | 3300031845 | Soil | MAPEKRREPPMPTDTIVVLVMAAAFGIFAATLYWADLRTRGVTK |
| Ga0318522_103941242 | 3300031894 | Soil | RRESRMPIDTIVVVLMAAAFGIFAATLYWADLRTRGLTR |
| Ga0306921_101349155 | 3300031912 | Soil | MMAPEERRESFMPTDTIVVLAMASAFGIFAATLYWAGLRTRGVSK |
| Ga0310913_111924011 | 3300031945 | Soil | LMPTDIIVVTLTAAAFGIFAATLYWADLHTGGLGK |
| Ga0310910_102975761 | 3300031946 | Soil | LAENRGSRLMPTDIIVVTLTAAAFGIFAATLYWADLHTGGLGK |
| Ga0310909_108781571 | 3300031947 | Soil | MLPHRNRGSRLMPTDIIVVALIAAAFGIFAAILYWADLHTGGLSK |
| Ga0306922_101177051 | 3300032001 | Soil | PSIMAPERRESSMPVDTIIVVLMAAAFGIFAATLYWADQRTRGLTR |
| Ga0318507_100450761 | 3300032025 | Soil | SMPVDTIVVVVMAAAFGIFAATLYWADLRTRGLTR |
| Ga0318507_105301552 | 3300032025 | Soil | VAENRGSRLMPTDINVVALIAGIFAATLYWADLHTGKLSK |
| Ga0318545_102719142 | 3300032042 | Soil | RGSRLMPTDINVVALIAGIFAATLYWADLHTGKLSK |
| Ga0318533_100482111 | 3300032059 | Soil | SRLMPIDIIVVALIAAAFGIFAATLYWADLRTRGLSK |
| Ga0318510_104500551 | 3300032064 | Soil | MAPPERRESSMPVDTIVVVLMAAAFGIFAATLYWADLRTRRLTR |
| Ga0306924_123004882 | 3300032076 | Soil | FMPMDTIVVVVMAAAFSIFAATLYWADLRTRGLSR |
| Ga0306920_1036458701 | 3300032261 | Soil | PERRESSMPVDTIIVVLMAAAFGIFAATLYWADLRTRGLSR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |