NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092684

Metagenome / Metatranscriptome Family F092684

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092684
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence GRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.87 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 95.33 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.701 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.346 % of family members)
Environment Ontology (ENVO) Unclassified
(47.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.682 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.96%    β-sheet: 5.97%    Coil/Unstructured: 85.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF12796Ank_2 53.27
PF13857Ank_5 14.02
PF13637Ank_4 11.21
PF11008DUF2846 0.93
PF01494FAD_binding_3 0.93
PF04191PEMT 0.93
PF00023Ank 0.93
PF00797Acetyltransf_2 0.93
PF14066DUF4256 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.87
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.93
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.93
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.93
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.37 %
UnclassifiedrootN/A19.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_62695All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1411Open in IMG/M
2228664021|ICCgaii200_c0699296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4563Open in IMG/M
3300000559|F14TC_100349942All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium647Open in IMG/M
3300000559|F14TC_103715835Not Available705Open in IMG/M
3300000789|JGI1027J11758_12469434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4586Open in IMG/M
3300000789|JGI1027J11758_12832070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4757Open in IMG/M
3300001431|F14TB_103732856Not Available692Open in IMG/M
3300001431|F14TB_109781179All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium568Open in IMG/M
3300002128|JGI24036J26619_10114292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4556Open in IMG/M
3300003321|soilH1_10088624All Organisms → cellular organisms → Bacteria → Proteobacteria4836Open in IMG/M
3300004156|Ga0062589_101801441All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300004157|Ga0062590_102403199All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300004463|Ga0063356_106048014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4519Open in IMG/M
3300004479|Ga0062595_100186255All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1264Open in IMG/M
3300004629|Ga0008092_11019173All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300004643|Ga0062591_100532136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41019Open in IMG/M
3300005180|Ga0066685_10902078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4590Open in IMG/M
3300005294|Ga0065705_10132691All Organisms → cellular organisms → Bacteria2393Open in IMG/M
3300005336|Ga0070680_100041058All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium3751Open in IMG/M
3300005343|Ga0070687_101529024Not Available503Open in IMG/M
3300005345|Ga0070692_10710199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4677Open in IMG/M
3300005444|Ga0070694_101448624All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia580Open in IMG/M
3300005458|Ga0070681_11350422All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium636Open in IMG/M
3300005546|Ga0070696_100186109All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1543Open in IMG/M
3300005558|Ga0066698_10735714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4646Open in IMG/M
3300005578|Ga0068854_101050580All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium723Open in IMG/M
3300005617|Ga0068859_102929874All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia522Open in IMG/M
3300005618|Ga0068864_101937123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4595Open in IMG/M
3300005718|Ga0068866_11299420Not Available528Open in IMG/M
3300005718|Ga0068866_11305982Not Available527Open in IMG/M
3300005719|Ga0068861_101496862All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium662Open in IMG/M
3300005834|Ga0068851_10655259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4643Open in IMG/M
3300005842|Ga0068858_100649516Not Available1025Open in IMG/M
3300005842|Ga0068858_100836677All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia899Open in IMG/M
3300005843|Ga0068860_100827688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4940Open in IMG/M
3300005844|Ga0068862_101099541All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae → Triatominae → Rhodnius790Open in IMG/M
3300005844|Ga0068862_101655317All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium648Open in IMG/M
3300005875|Ga0075293_1047734Not Available608Open in IMG/M
3300006169|Ga0082029_1312147Not Available500Open in IMG/M
3300006846|Ga0075430_101679694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4521Open in IMG/M
3300006854|Ga0075425_100738102Not Available1130Open in IMG/M
3300006871|Ga0075434_102661382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4500Open in IMG/M
3300006876|Ga0079217_10488165All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium761Open in IMG/M
3300006904|Ga0075424_100575578Not Available1203Open in IMG/M
3300006931|Ga0097620_101860915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4665Open in IMG/M
3300007004|Ga0079218_13561648All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium529Open in IMG/M
3300009093|Ga0105240_11447082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4721Open in IMG/M
3300009093|Ga0105240_12408947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4545Open in IMG/M
3300009101|Ga0105247_10835427All Organisms → cellular organisms → Eukaryota → Opisthokonta706Open in IMG/M
3300009101|Ga0105247_10932328All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia673Open in IMG/M
3300009147|Ga0114129_13014309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4553Open in IMG/M
3300009148|Ga0105243_11508927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4696Open in IMG/M
3300009162|Ga0075423_10256693All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1831Open in IMG/M
3300009174|Ga0105241_12226038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4544Open in IMG/M
3300009545|Ga0105237_10225601All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300009553|Ga0105249_11724895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae699Open in IMG/M
3300010038|Ga0126315_10584840All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium719Open in IMG/M
3300010040|Ga0126308_10905074All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300010041|Ga0126312_10928171Not Available635Open in IMG/M
3300010046|Ga0126384_12506047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4501Open in IMG/M
3300010047|Ga0126382_12356214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4516Open in IMG/M
3300010373|Ga0134128_10876850Not Available994Open in IMG/M
3300010375|Ga0105239_12057604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea663Open in IMG/M
3300010396|Ga0134126_10229222All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300010397|Ga0134124_12926443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4521Open in IMG/M
3300010399|Ga0134127_10861749All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium958Open in IMG/M
3300010403|Ga0134123_10666141All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta1012Open in IMG/M
3300012015|Ga0120187_1017592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga709Open in IMG/M
3300012045|Ga0136623_10032337All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300012212|Ga0150985_111200071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4529Open in IMG/M
3300012285|Ga0137370_10906538All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium545Open in IMG/M
3300012363|Ga0137390_11565290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4598Open in IMG/M
3300012948|Ga0126375_11052609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4667Open in IMG/M
3300012948|Ga0126375_11559846All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium567Open in IMG/M
3300012958|Ga0164299_11478846All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014326|Ga0157380_10304818Not Available1469Open in IMG/M
3300014326|Ga0157380_12151329Not Available621Open in IMG/M
3300014745|Ga0157377_10379888Not Available956Open in IMG/M
3300014745|Ga0157377_11592065All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium523Open in IMG/M
3300015373|Ga0132257_100987563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1059Open in IMG/M
3300015373|Ga0132257_101317742Not Available917Open in IMG/M
3300015374|Ga0132255_103554007Not Available663Open in IMG/M
3300018027|Ga0184605_10188173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4935Open in IMG/M
3300025899|Ga0207642_11044757Not Available527Open in IMG/M
3300025900|Ga0207710_10651028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4552Open in IMG/M
3300025904|Ga0207647_10366401All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia815Open in IMG/M
3300025911|Ga0207654_10241587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41207Open in IMG/M
3300025911|Ga0207654_11316502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4527Open in IMG/M
3300025912|Ga0207707_10608577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4924Open in IMG/M
3300025917|Ga0207660_10256367All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1382Open in IMG/M
3300025918|Ga0207662_10442462Not Available887Open in IMG/M
3300025927|Ga0207687_10914273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095751Open in IMG/M
3300025933|Ga0207706_10559629All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia984Open in IMG/M
3300025936|Ga0207670_11747456All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium529Open in IMG/M
3300025937|Ga0207669_10992339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4705Open in IMG/M
3300025960|Ga0207651_10631570All Organisms → cellular organisms → Eukaryota939Open in IMG/M
3300025981|Ga0207640_10912953Not Available768Open in IMG/M
3300026041|Ga0207639_11852072All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia564Open in IMG/M
3300026116|Ga0207674_10296657All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300026116|Ga0207674_10856876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4876Open in IMG/M
3300027775|Ga0209177_10374315Not Available564Open in IMG/M
3300027909|Ga0209382_12332355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4502Open in IMG/M
3300028380|Ga0268265_10402230All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1266Open in IMG/M
3300031901|Ga0307406_11676399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4563Open in IMG/M
3300031908|Ga0310900_11837680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4516Open in IMG/M
3300032013|Ga0310906_10396649All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium910Open in IMG/M
3300033412|Ga0310810_10258047All Organisms → cellular organisms → Bacteria1911Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.35%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.93%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012015Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_007978602199352025SoilVRVGRDDGKGFLVVTRYQLKDIEMGKVQDPLIQPGDRITVIN
ICCgaii200_069929622228664021SoilIVGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRIMVQ
F14TC_10034994213300000559SoilVRIGRDNGKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN*
F14TC_10371583513300000559SoilGGLAKNSKEARLARDNGKGXXXXXXYKLKDIDSGKVPDPLVQPGDRITIVK*
JGI1027J11758_1246943423300000789SoilDDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK*
JGI1027J11758_1283207013300000789SoilARLARDNGKGFLVLSRYKLKDIDSGKVPDPLVQPGDRITVVK*
F14TB_10373285623300001431SoilHGFLVVNRYKLKDIDSGRVPDPVIQPGDRITIID*
F14TB_10978117923300001431SoilGKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN*
JGI24036J26619_1011429223300002128Corn, Switchgrass And Miscanthus RhizosphereIAREDGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD*
soilH1_1008862413300003321Sugarcane Root And Bulk SoilVTPKAKEARLGRDDGHGFLTITRLKLKDIESGKLPDPVVRPGDRIMIVK*
Ga0062589_10180144113300004156SoilKKAELARDNGKGFLVVTRFKLKEIESGKVPDPPIQPGDRITIIK*
Ga0062590_10240319913300004157SoilARDNGKGFLMVTRFKLKEIESGKVPDPPIQPGDRITIIK*
Ga0063356_10604801423300004463Arabidopsis Thaliana RhizosphereARLARDNGNGYLVMHRFKLKDIDSGKAPDPPIQPGDRITIVK*
Ga0062595_10018625533300004479SoilKPKEARIGRNDAGGFIVVTRYQLKDIESGKVQDPLVQPGDRIMVSN*
Ga0008092_1101917313300004629Tropical Rainforest SoilAKEVRLARDNGKGFLTISHYKLKEVNSGRTADPVLQPGDRITIGK*
Ga0062591_10053213623300004643SoilAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0066685_1090207823300005180SoilKEARFARDNGKGFLVVNRYKLKAIESGKVPDPVIQPGDRITIID*
Ga0065705_1013269153300005294Switchgrass RhizosphereRIGRDDGKGFLVVTRFKLKEIESGKVPDPVIKPGDRITIRD*
Ga0070680_10004105813300005336Corn RhizosphereKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0070687_10152902423300005343Switchgrass RhizosphereKAQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID*
Ga0070692_1071019913300005345Corn, Switchgrass And Miscanthus RhizosphereVTNKAKEARLGRDDGNGYLTVTKIKLKDIESGKAPDPLVRPGDRIMIDK*
Ga0070694_10144862413300005444Corn, Switchgrass And Miscanthus RhizosphereEVRLARDDGKGFLNVTRYRLKEIEEGKTQDPLIQPGDRITIIF*
Ga0070681_1135042223300005458Corn RhizosphereRVARDNGEGFLAVTRYKLKDVESGKVQDPVVKPGDRITIRN*
Ga0070696_10018610913300005546Corn, Switchgrass And Miscanthus RhizosphereKPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0066698_1073571413300005558SoilTKKSKEARLARDNGKGFLVVSRYKLKDIESGKVPDPVIQPGDRITIID*
Ga0068854_10105058013300005578Corn RhizosphereDNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND*
Ga0068859_10292987423300005617Switchgrass RhizosphereARIGRDDGKGFLVVTRFKLKEIESGKIQDPIIKPGDRITIGH*
Ga0068864_10193712323300005618Switchgrass RhizosphereTPKAKEARLGRDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068866_1129942013300005718Miscanthus RhizosphereSRDSGNGFLMMTRYKLQEIDSGKRPDPLVQPGDRITVVK*
Ga0068866_1130598213300005718Miscanthus RhizosphereVRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE*
Ga0068861_10149686213300005719Switchgrass RhizosphereTSKGKEARIGRDDGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD*
Ga0068851_1065525913300005834Corn RhizosphereTPKAKEARLGRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE*
Ga0068858_10064951613300005842Switchgrass RhizosphereQLGRDDGKGFLVVTKFKLKEIESGKAQDPVVKPGDRITIKE*
Ga0068858_10083667713300005842Switchgrass RhizosphereDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068860_10082768823300005843Switchgrass RhizosphereVTTKAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068862_10109954113300005844Switchgrass RhizosphereLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ*
Ga0068862_10165531713300005844Switchgrass RhizosphereDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0075293_104773413300005875Rice Paddy SoilPKGKEARLGRDDGKGYLVVTKFKLKDVEAGKVQDPTLKPGDRITIKE*
Ga0082029_131214723300006169Termite NestDGKGFLTVTKFKLKDIETGKVQDPGVKPGDRITIKE*
Ga0075430_10167969423300006846Populus RhizosphereLARDDGKGFLIVNRYKLQDIESGKMKDPLIEPGDRITIND*
Ga0075425_10073810213300006854Populus RhizosphereRDNGKGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK*
Ga0075434_10266138213300006871Populus RhizosphereTAREAQVARDNGKGFLAVTRYKLKEIDSGKIADPAIQPGDRITITD*
Ga0079217_1048816523300006876Agricultural SoilGKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ*
Ga0075424_10057557823300006904Populus RhizosphereGRGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK*
Ga0097620_10186091513300006931Switchgrass RhizosphereVTNKAKEARLGRDDGNGYLTITKIKLKDIESGKAPDPLVRPGDRIMIVD*
Ga0079218_1356164823300007004Agricultural SoilGRGFLIVTKFKLKDIESGKVPDPLIRPGDRITVVE*
Ga0105240_1144708213300009093Corn RhizosphereLTKNPKEARLARDSGKGFLVQSRYKLKDIDSGKVPDPLVQPGDRITIVK*
Ga0105240_1240894723300009093Corn RhizosphereGGVTALAKQARLGRDNGKGFLVVNSYKLKDVDSGKIPDPVLQPGDRITIE*
Ga0105247_1083542723300009101Switchgrass RhizosphereRDDGNGFLVVNRYKLKDIESGKVQDPVVKPGDRIVIRD*
Ga0105247_1093232813300009101Switchgrass RhizosphereLGRDDGKGFLVVTRYKLKEIESGKVQDPGVKPGDRITIKE*
Ga0114129_1301430923300009147Populus RhizosphereGRDNGDGFLVVTRYKLKDIDSGKVQDPVVKPGDRITIHD*
Ga0105243_1150892723300009148Miscanthus RhizosphereGDGFLVVTRYKLKDIESGKVQDPLVKPGDRITIHD*
Ga0075423_1025669313300009162Populus RhizosphereRDDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK*
Ga0105241_1222603813300009174Corn RhizospherePRKLKEARLSRDNGKGFLVVNRYKLKDIDSGRMPDPLLQPGDRVTVTK*
Ga0105237_1022560133300009545Corn RhizosphereGKGFLVVTRFKLKEIESGKIQDPVIKPGDRITIGH*
Ga0105249_1172489513300009553Switchgrass RhizosphereEATLGRDDGKGFLVVTKYKLKEIESGKVQDPVVKPGDRITIKE*
Ga0126315_1058484023300010038Serpentine SoilNGFLVVTRYKLKDIESGKVPDPAVKPGDRITIRD*
Ga0126308_1090507413300010040Serpentine SoilPKAKEARLGRDDGKGFLIVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0126312_1092817123300010041Serpentine SoilGKGFLVITTYKLKEIESGKAQDPAVKPGDRITIKE*
Ga0126384_1250604713300010046Tropical Forest SoilARIGRDDGKGFLVVTRFKLKEIESGKIQDPLVKPGDRITIRD*
Ga0126382_1235621433300010047Tropical Forest SoilDNGKGFLVVNRYKLKDINSGKVPDPLIQAGDRITIE*
Ga0134128_1087685023300010373Terrestrial SoilKGFLNVIRYKLEEIESGKLQDPLIQPGDRILIVN*
Ga0105239_1205760423300010375Corn RhizosphereKAKEARLGRDDGSGFLAVTVYKLKDIESGKAQDPVLKPGDRITIKD*
Ga0134126_1022922233300010396Terrestrial SoilGKGFLIVTKFKLKEIESGKVQDPTVKPGDRITIKE*
Ga0134124_1292644313300010397Terrestrial SoilTEARLWRDDGKGFLKETRYKLKEIASGKLLDPLIQPGDRITIIN*
Ga0134127_1086174913300010399Terrestrial SoilGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRITVIQ*
Ga0134123_1066614123300010403Terrestrial SoilKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0120187_101759223300012015TerrestrialKEARLARDDGKGFLAVTRYKLKEIESGKVQDPLVKPGDRITIKE*
Ga0136623_1003233733300012045Polar Desert SandDDGKGFLSVSRYKLKDIDSGKQPDPLIQPGDRITIVD*
Ga0150985_11120007123300012212Avena Fatua RhizosphereVTPKAKEARLGRDDGKGFLVVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0137370_1090653813300012285Vadose Zone SoilQARLGRDDGNGFLVINHFKLKDIESGKVPDPVVKPGDRIMIVE*
Ga0137390_1156529013300012363Vadose Zone SoilEARIARDDGKGFLVVNRYKLKDIDSGKLPDPLIQPGDRITIVD*
Ga0126375_1105260923300012948Tropical Forest SoilGKGFLAVSRYKLKDIEKGKVADPVIQPGDRITIIK*
Ga0126375_1155984623300012948Tropical Forest SoilKEARLARDNGKGFLSVTRYKLKEINSGKVPDPVIQAGDRITIEH*
Ga0164299_1147884613300012958SoilRDDGKGFLVVTKYKLNEIESGKVQDPAVKPGDRITIKE*
Ga0157380_1030481823300014326Switchgrass RhizosphereGRGLLAVKRYKLKEIDSGKVPDPVIQPGDRITIID*
Ga0157380_1215132913300014326Switchgrass RhizosphereGKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD*
Ga0157377_1037988823300014745Miscanthus RhizosphereRDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0157377_1159206513300014745Miscanthus RhizospherePREVRVGRDDGKGFLAVTRYQLKDIEMGKVQDPLIQPGDRITVIN*
Ga0132257_10098756313300015373Arabidopsis RhizosphereARLARDDGKGFLIITKYKLKDIDSAKLPDPIIQPGDRITIID*
Ga0132257_10131774223300015373Arabidopsis RhizosphereRDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK*
Ga0132255_10355400723300015374Arabidopsis RhizosphereGKGFLVQSRYKLKDIDSGKVPGPLVQPGDRITIVK*
Ga0184605_1018817323300018027Groundwater SedimentGKPKEARLARDDGKGFLVVSRYKLKDIDSGKLPDPSIQPGDRITIVD
Ga0207642_1104475723300025899Miscanthus RhizosphereVRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE
Ga0207710_1065102813300025900Switchgrass RhizosphereKAKEARLGRDNGEGFLVVTRYKLKDIESGKVADPIVKPGDRITIHD
Ga0207647_1036640113300025904Corn RhizosphereGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0207654_1024158723300025911Corn RhizosphereDNGEGFLVVTRYRLKDIESGKVPDPVVKPGDRITIHD
Ga0207654_1131650213300025911Corn RhizosphereGRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD
Ga0207707_1060857713300025912Corn RhizosphereKGKEARLGRDDGHGFLTVTKFKLKEIESGKIADPVVHPGDRITIME
Ga0207660_1025636713300025917Corn RhizosphereGGVVDKPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK
Ga0207662_1044246223300025918Switchgrass RhizosphereAQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID
Ga0207687_1091427333300025927Miscanthus RhizosphereMCAVRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE
Ga0207706_1055962913300025933Corn RhizosphereRLGRDDGNGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0207670_1174745613300025936Switchgrass RhizosphereDGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD
Ga0207669_1099233913300025937Miscanthus RhizosphereGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD
Ga0207651_1063157023300025960Switchgrass RhizosphereKVKEARLARDDGKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD
Ga0207640_1091295313300025981Corn RhizosphereKEAQVGRDNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND
Ga0207639_1185207213300026041Corn RhizosphereDGKGFLVVTRYKLKEIESGKVQDPDVKPGDRITIKE
Ga0207674_1029665713300026116Corn RhizosphereNGEGFLVVTRYKLKEIESGKVQDPVVKPGDRITIRD
Ga0207674_1085687623300026116Corn RhizosphereKEARLGRDDGRGFLILTKFKLKDIESGKVPDPLLRPGDRITVVK
Ga0209177_1037431523300027775Agricultural SoilGKKAELARDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK
Ga0209382_1233235513300027909Populus RhizosphereDGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD
Ga0268265_1040223013300028380Switchgrass RhizosphereKAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0307406_1167639913300031901RhizosphereVLGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRVTVIE
Ga0310900_1183768013300031908SoilAGGVVEKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRIMVVK
Ga0310906_1039664913300032013SoilDDGKGFLIVNRYKLQEIESGKLKDPLIEPGDRITIND
Ga0310810_1025804713300033412SoilRDDGKGFLTVTKYKLKDIESGKVQDPVVKPGDRITIKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.