Basic Information | |
---|---|
Family ID | F092599 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | VGSDSGGRRRRAFRSLAGNRALVRVLAGYALFVLTEYAVWIAM |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 93.46 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 93.46 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.271 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.252 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.794 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (43.925 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF02687 | FtsX | 8.41 |
PF00892 | EamA | 3.74 |
PF08241 | Methyltransf_11 | 3.74 |
PF13561 | adh_short_C2 | 2.80 |
PF13549 | ATP-grasp_5 | 2.80 |
PF13560 | HTH_31 | 2.80 |
PF01266 | DAO | 2.80 |
PF02781 | G6PD_C | 2.80 |
PF10604 | Polyketide_cyc2 | 2.80 |
PF00106 | adh_short | 1.87 |
PF01243 | Putative_PNPOx | 1.87 |
PF00027 | cNMP_binding | 1.87 |
PF08352 | oligo_HPY | 1.87 |
PF10009 | DUF2252 | 1.87 |
PF05532 | CsbD | 0.93 |
PF00496 | SBP_bac_5 | 0.93 |
PF00400 | WD40 | 0.93 |
PF00903 | Glyoxalase | 0.93 |
PF03475 | 3-alpha | 0.93 |
PF03473 | MOSC | 0.93 |
PF00111 | Fer2 | 0.93 |
PF00005 | ABC_tran | 0.93 |
PF00355 | Rieske | 0.93 |
PF00296 | Bac_luciferase | 0.93 |
PF04672 | Methyltransf_19 | 0.93 |
PF01699 | Na_Ca_ex | 0.93 |
PF08240 | ADH_N | 0.93 |
PF00291 | PALP | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 2.80 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.93 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.93 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 0.93 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.27 % |
Unclassified | root | N/A | 46.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10525418 | Not Available | 695 | Open in IMG/M |
3300005180|Ga0066685_10482790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 859 | Open in IMG/M |
3300005332|Ga0066388_103757860 | Not Available | 775 | Open in IMG/M |
3300005577|Ga0068857_100479481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1165 | Open in IMG/M |
3300005764|Ga0066903_107742936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300006059|Ga0075017_101694264 | Not Available | 500 | Open in IMG/M |
3300006173|Ga0070716_100534026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium colombiense | 871 | Open in IMG/M |
3300006175|Ga0070712_100673254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium colombiense | 880 | Open in IMG/M |
3300009400|Ga0116854_1123853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. MYb227 | 613 | Open in IMG/M |
3300009553|Ga0105249_11707661 | Not Available | 702 | Open in IMG/M |
3300010358|Ga0126370_12109823 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010358|Ga0126370_12153484 | Not Available | 548 | Open in IMG/M |
3300010360|Ga0126372_11938892 | Not Available | 635 | Open in IMG/M |
3300010361|Ga0126378_11447921 | Not Available | 778 | Open in IMG/M |
3300010362|Ga0126377_11653389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 715 | Open in IMG/M |
3300010371|Ga0134125_10268741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1894 | Open in IMG/M |
3300010375|Ga0105239_13093935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 542 | Open in IMG/M |
3300010375|Ga0105239_13175799 | Not Available | 535 | Open in IMG/M |
3300010379|Ga0136449_100079414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 6933 | Open in IMG/M |
3300010379|Ga0136449_103289586 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300010379|Ga0136449_103702098 | Not Available | 577 | Open in IMG/M |
3300010868|Ga0124844_1248625 | Not Available | 625 | Open in IMG/M |
3300010876|Ga0126361_10960084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. 9N | 1763 | Open in IMG/M |
3300010880|Ga0126350_12453112 | Not Available | 717 | Open in IMG/M |
3300012199|Ga0137383_10727080 | Not Available | 725 | Open in IMG/M |
3300012357|Ga0137384_10092855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
3300012508|Ga0157315_1015155 | Not Available | 747 | Open in IMG/M |
3300012924|Ga0137413_11177764 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012929|Ga0137404_11280017 | Not Available | 675 | Open in IMG/M |
3300012977|Ga0134087_10284309 | Not Available | 770 | Open in IMG/M |
3300013307|Ga0157372_12500057 | Not Available | 593 | Open in IMG/M |
3300016294|Ga0182041_10463897 | Not Available | 1091 | Open in IMG/M |
3300016341|Ga0182035_11167508 | Not Available | 687 | Open in IMG/M |
3300016387|Ga0182040_10089681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2054 | Open in IMG/M |
3300017937|Ga0187809_10149690 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300017955|Ga0187817_10463581 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300017974|Ga0187777_10294037 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300017974|Ga0187777_11154815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300018085|Ga0187772_11403146 | Not Available | 518 | Open in IMG/M |
3300020580|Ga0210403_11184906 | Not Available | 589 | Open in IMG/M |
3300020582|Ga0210395_10847804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
3300021407|Ga0210383_11150477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300025898|Ga0207692_10606309 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300025915|Ga0207693_10940115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 662 | Open in IMG/M |
3300025916|Ga0207663_10978014 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300025929|Ga0207664_11601782 | Not Available | 573 | Open in IMG/M |
3300026095|Ga0207676_10229460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1659 | Open in IMG/M |
3300026550|Ga0209474_10319424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 897 | Open in IMG/M |
3300027775|Ga0209177_10170681 | Not Available | 753 | Open in IMG/M |
3300028380|Ga0268265_10295182 | Not Available | 1457 | Open in IMG/M |
3300030494|Ga0310037_10307933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-004 | 673 | Open in IMG/M |
3300030743|Ga0265461_11174374 | Not Available | 788 | Open in IMG/M |
3300031543|Ga0318516_10613279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 621 | Open in IMG/M |
3300031564|Ga0318573_10211189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
3300031572|Ga0318515_10252379 | Not Available | 946 | Open in IMG/M |
3300031680|Ga0318574_10116249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
3300031682|Ga0318560_10073592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1729 | Open in IMG/M |
3300031708|Ga0310686_104941074 | Not Available | 776 | Open in IMG/M |
3300031713|Ga0318496_10365316 | Not Available | 797 | Open in IMG/M |
3300031751|Ga0318494_10423632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
3300031765|Ga0318554_10040905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2517 | Open in IMG/M |
3300031770|Ga0318521_10809159 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300031778|Ga0318498_10179663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 962 | Open in IMG/M |
3300031778|Ga0318498_10196127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 916 | Open in IMG/M |
3300031779|Ga0318566_10398524 | Not Available | 677 | Open in IMG/M |
3300031781|Ga0318547_10217609 | Not Available | 1145 | Open in IMG/M |
3300031782|Ga0318552_10334971 | Not Available | 770 | Open in IMG/M |
3300031782|Ga0318552_10509441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 614 | Open in IMG/M |
3300031792|Ga0318529_10142801 | Not Available | 1098 | Open in IMG/M |
3300031795|Ga0318557_10097573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1297 | Open in IMG/M |
3300031798|Ga0318523_10268597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
3300031799|Ga0318565_10027750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2542 | Open in IMG/M |
3300031805|Ga0318497_10787128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
3300031821|Ga0318567_10747161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 555 | Open in IMG/M |
3300031845|Ga0318511_10183641 | Not Available | 925 | Open in IMG/M |
3300031846|Ga0318512_10180916 | Not Available | 1026 | Open in IMG/M |
3300031893|Ga0318536_10571699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
3300031910|Ga0306923_11957584 | Not Available | 596 | Open in IMG/M |
3300031910|Ga0306923_12396763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300031912|Ga0306921_10269525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1994 | Open in IMG/M |
3300031912|Ga0306921_11424901 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300031912|Ga0306921_12068871 | Not Available | 604 | Open in IMG/M |
3300031941|Ga0310912_10899655 | Not Available | 681 | Open in IMG/M |
3300032001|Ga0306922_11136917 | Not Available | 798 | Open in IMG/M |
3300032008|Ga0318562_10481572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
3300032009|Ga0318563_10138019 | Not Available | 1304 | Open in IMG/M |
3300032039|Ga0318559_10040314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1915 | Open in IMG/M |
3300032043|Ga0318556_10261224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes tereljensis | 904 | Open in IMG/M |
3300032063|Ga0318504_10105459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
3300032064|Ga0318510_10299650 | Not Available | 670 | Open in IMG/M |
3300032065|Ga0318513_10399933 | Not Available | 670 | Open in IMG/M |
3300032066|Ga0318514_10336982 | Not Available | 798 | Open in IMG/M |
3300032067|Ga0318524_10344929 | Not Available | 773 | Open in IMG/M |
3300032068|Ga0318553_10109915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1410 | Open in IMG/M |
3300032076|Ga0306924_11510707 | Not Available | 712 | Open in IMG/M |
3300032076|Ga0306924_11559015 | Not Available | 698 | Open in IMG/M |
3300032261|Ga0306920_102936887 | Not Available | 645 | Open in IMG/M |
3300032782|Ga0335082_11536489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
3300032828|Ga0335080_10091208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3379 | Open in IMG/M |
3300032896|Ga0335075_10483678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1274 | Open in IMG/M |
3300032897|Ga0335071_11083668 | Not Available | 747 | Open in IMG/M |
3300032954|Ga0335083_11499847 | Not Available | 512 | Open in IMG/M |
3300033158|Ga0335077_11558185 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300033289|Ga0310914_10051859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3385 | Open in IMG/M |
3300033290|Ga0318519_10125441 | Not Available | 1410 | Open in IMG/M |
3300033806|Ga0314865_148090 | Not Available | 624 | Open in IMG/M |
3300034268|Ga0372943_0976188 | Not Available | 564 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.87% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_105254182 | 3300001593 | Forest Soil | VGGDSGGRLHAFRSLAANAALVRILAAYALFVLTE |
Ga0066685_104827901 | 3300005180 | Soil | VGTDSGGRRRRAFGSLAGNKALLRVLAAYVLFILAENSVWIA |
Ga0066388_1037578602 | 3300005332 | Tropical Forest Soil | VGSDSGGRRRHAFGSLAVNRALVRVLAGYVLFVLTEYSVWIAM |
Ga0068857_1004794811 | 3300005577 | Corn Rhizosphere | MGGDRGGRRRHAFSSLAGNTALLRVLAAYLLFILTEYAVWIAMLVFAYNRG |
Ga0066903_1077429361 | 3300005764 | Tropical Forest Soil | VGSDSGAHRMHAFRSLTGNRALLRVLGGYALFTLNEYAVWIAMLVY |
Ga0075017_1016942641 | 3300006059 | Watersheds | VGGDSDARLGAFRSLVGNRALVRVVGGYALFAVTQY |
Ga0070716_1005340263 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGDHSGRRRRAFSSLAGNTALLRVLAAYLLFILTE |
Ga0070712_1006732541 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGDHSGRRRRAFSSLAGNTALLRVLAAYLLFILTEYAV |
Ga0116854_11238531 | 3300009400 | Soil | VGGDSGGGRRLRALRSLAGNRALVRVLGGYVLFILTEYSVWIA |
Ga0105249_117076612 | 3300009553 | Switchgrass Rhizosphere | MGGDRSGRRRRAFSSLAGNTALLRVLAAYLLFILT |
Ga0126370_121098231 | 3300010358 | Tropical Forest Soil | VGGNSGGRRLRAFGSLAGNGALLRVLAAYMMFILTEYAV |
Ga0126370_121534841 | 3300010358 | Tropical Forest Soil | VGSDSGGRRRRAFRSLAGNRALVRVLAGYALFVLTEYAVWIAM |
Ga0126372_119388921 | 3300010360 | Tropical Forest Soil | VEGGSASGRLGAFRSLTGNRPLLRVLAGYALFILTEYAVWIAMLV |
Ga0126378_114479212 | 3300010361 | Tropical Forest Soil | VGSDSGARYLHAFRSLTGNRTLLRVLGGYALFTLN |
Ga0126377_116533892 | 3300010362 | Tropical Forest Soil | MVAGDSDARRLRAFRSLAGNRALLRVLGAYTLFILT |
Ga0134125_102687411 | 3300010371 | Terrestrial Soil | MGGDRSGRRRRAFSSLAGNTALLRVLAAYLLFILTEYAVWIAMLV |
Ga0105239_130939352 | 3300010375 | Corn Rhizosphere | VGGDSGARRLRAFRSLAANTALLRVLGGYTLFILTEYS |
Ga0105239_131757991 | 3300010375 | Corn Rhizosphere | MDSGRRLRAFGSLAGNRALLRVLAAYLLFILTEYAVWIAML |
Ga0136449_1000794141 | 3300010379 | Peatlands Soil | LVGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTEYSAWIAML |
Ga0136449_1032895862 | 3300010379 | Peatlands Soil | VGGDSGGGRLHAFRSLAGNRALLRVLCAYGLFILTECAVWLAMIIVAYSHGG |
Ga0136449_1037020982 | 3300010379 | Peatlands Soil | VSGDSSGRLHAFRSLAGNRTLVRILAGYALFDLTEYSA |
Ga0124844_12486252 | 3300010868 | Tropical Forest Soil | MGGDRSGRRRRAFSSLAGNPALLRVLAAYLLFILTEYAVWIAMLVYAYNR |
Ga0126361_109600841 | 3300010876 | Boreal Forest Soil | MQGGARRAFRSLAGNRALVRVLAAYVMFGLTEAAVWIAML |
Ga0126350_124531121 | 3300010880 | Boreal Forest Soil | MDSGGPRGGRGRAFRSLTGNRALGRVLAAYVMFTLSEDAVWIAMLV |
Ga0137383_107270801 | 3300012199 | Vadose Zone Soil | MDSGRRRLRAFGSLAGNRALLRVLAAYLLFILTE* |
Ga0137384_100928551 | 3300012357 | Vadose Zone Soil | VGGDSGARRLGAFRSLAGNRALVRVVGGYALFILTEYSVWVAML |
Ga0157315_10151551 | 3300012508 | Arabidopsis Rhizosphere | MDGDRSGRRRHAFSSLAANTALLRVLAAYLLFILTEYAVWIAM |
Ga0137413_111777641 | 3300012924 | Vadose Zone Soil | VRDDTGRRRRRAFSSLTGNRALLRVLAAYLLFILTEYA |
Ga0137404_112800171 | 3300012929 | Vadose Zone Soil | MDSGGRRRRAFSSLAGNTALLGVLAAYLLFILTEYAVWIAMLVFAYN |
Ga0134087_102843092 | 3300012977 | Grasslands Soil | VLVGTDSGGRRRRAFGSLAGNKALLRVLAAYVLFILAENSVWIAM |
Ga0157372_125000572 | 3300013307 | Corn Rhizosphere | VGTDSGGRRRRAFGSVAGNKALLRVLVAYVLFILTE |
Ga0182041_104638971 | 3300016294 | Soil | VLVGSDSGSRRHAFRSLAGNRALLRVLAGYGLFVLTEYSVWIGMLVFAYSRG |
Ga0182035_111675082 | 3300016341 | Soil | VGGDSGVGGLHAFRSLVANKALLRVLGGYALFTLTEYSAWIAI |
Ga0182040_100896814 | 3300016387 | Soil | VGGDSGGRRLHAFRSLAGNRALLSVLAAYVMFILAEYAAWIAMLVYAY |
Ga0187809_101496902 | 3300017937 | Freshwater Sediment | VGGDSGGRRLHAFRSLAGNRVLVRVLSGYGLFILTEYAVWLAMII |
Ga0187817_104635811 | 3300017955 | Freshwater Sediment | VGDGSSARRLHTFRSLAANHALLRVLGGYGLFVLTEYA |
Ga0187777_102940372 | 3300017974 | Tropical Peatland | VGGNSGGRRVRAFGSLAGNGALLRVLAGYVMFILAEYAVWIA |
Ga0187777_111548151 | 3300017974 | Tropical Peatland | VGSDPGGRRLHAFRSLAGNRALLRVLVAYSLFTLTEYSVWIAM |
Ga0187772_114031461 | 3300018085 | Tropical Peatland | VGSGSGGRLHAFRSLAGNRALLRVLAGYALFVLTEYSVWIAMLIYAFS |
Ga0210403_111849062 | 3300020580 | Soil | MDSGRRRLRAFGSLAGNRALLRVLAAYLLFILTEY |
Ga0210395_108478041 | 3300020582 | Soil | MDSGRRRLRAFGSLAGNRALLRVLAAYLLFILTEYAVWIAMLV |
Ga0210383_111504772 | 3300021407 | Soil | MGGDSGTGGLHAVRSLAANGALLRVLVGYALFILTEYSVWIAMMVYAYSRG |
Ga0207692_106063092 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGDHSGRRRRAFSSLAGNTALLRVLAAYLLFILTEYAVWIAMLVFAYNR |
Ga0207693_109401151 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGDHSGRRRRAFSSLAGNTALLRVLAAYLLFILTEYAVWIAM |
Ga0207663_109780143 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSGRRRLRAFGSLAGNRALLRVLAAYLLFILTEYAVWI |
Ga0207664_116017821 | 3300025929 | Agricultural Soil | MDSGRRRLRAFGSLAGNRALLRVLAAYLLFILTEYAVWIAML |
Ga0207676_102294601 | 3300026095 | Switchgrass Rhizosphere | VGSDSGGRRRAFRSLTRTRALLRVLGGYALFTLNEYAVWIAMLV |
Ga0209474_103194242 | 3300026550 | Soil | VGGDSGARRLRAFRSLAGNTALLRVLGGYTLFILT |
Ga0209177_101706811 | 3300027775 | Agricultural Soil | MGGDRSGCRRHAFSSLAGNTALLRVLAAYLLFILTEY |
Ga0268265_102951821 | 3300028380 | Switchgrass Rhizosphere | MGGDRGGRRRHAFSSLAGNTALLRVLAAYLLFILTEYAVWIAM |
Ga0310037_103079331 | 3300030494 | Peatlands Soil | LVGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTEYSAWIAMLV |
Ga0265461_111743742 | 3300030743 | Soil | VGGDSGGRLHAFRSLAANGALVRILAAYALFVLTECTAWIAMLVFAY |
Ga0318516_106132792 | 3300031543 | Soil | VGGNSGGRRLRAFGSLAGNSALLRVLAAYVMFILTEYAVWIAMLV |
Ga0318573_102111892 | 3300031564 | Soil | VDSDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAM |
Ga0318515_102523792 | 3300031572 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILV |
Ga0318574_101162493 | 3300031680 | Soil | VDSDPGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAMLVYAYG |
Ga0318560_100735921 | 3300031682 | Soil | VGGDSGGRRLHAFRSLAGNRALLSVLAAYVMFILAEYAA |
Ga0310686_1049410741 | 3300031708 | Soil | VGSSAGARRLHAFRSLADNKALMRALAAYALFVLAEYSVWIAMLVF |
Ga0318496_103653161 | 3300031713 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLT |
Ga0318494_104236321 | 3300031751 | Soil | VGDGSRARLHAFRSLPVNRVLLRVLAGYALFVLTEYAVWIAM |
Ga0318554_100409054 | 3300031765 | Soil | VGGDSGGRRLHAFRSLAGNRALLSVLAAYVMFILAEYAAWIAMLVYAYS |
Ga0318521_108091592 | 3300031770 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVYAY |
Ga0318498_101796632 | 3300031778 | Soil | VGDGSRARLHAFRSLPVNRVLLRVLAGYALFVLTEYA |
Ga0318498_101961271 | 3300031778 | Soil | VGSDSGSRRHAFRSLAGNGALVRVLTGYLLFVLTEYSVWIAMLVFAYS |
Ga0318566_103985242 | 3300031779 | Soil | VGGDSGVGRLHAFRSLVANKALLRVRGGYALFTLTEYSVWIAILVYAY |
Ga0318547_102176092 | 3300031781 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVYAYSR |
Ga0318552_103349712 | 3300031782 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEY |
Ga0318552_105094411 | 3300031782 | Soil | VGGNSGGRRLRAFGSLAGNGALLRVLAAYMVFILTEYAVWIAM |
Ga0318529_101428011 | 3300031792 | Soil | VGGDSGAGGLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVYAYS |
Ga0318557_100975731 | 3300031795 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTE |
Ga0318523_102685972 | 3300031798 | Soil | MSSDSGGRRRRAFRSLAGNRALVRVLAGYALFVLTEYAVWI |
Ga0318565_100277504 | 3300031799 | Soil | VGNDSSGRRRRAFRSLAGNSALLRVLAGYVLFTLTEYSV |
Ga0318497_107871281 | 3300031805 | Soil | VGSDSSGRRWRAFRSLAGNSALLRVLAGYVLFTLTEYSVWI |
Ga0318567_107471612 | 3300031821 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAMLV |
Ga0318511_101836411 | 3300031845 | Soil | VDSDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAML |
Ga0318512_101809161 | 3300031846 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAI |
Ga0318536_105716991 | 3300031893 | Soil | VSSDSGSRRHAFRSLAGNGALVRVLTGYLLFVLTEYSVWIA |
Ga0306923_119575841 | 3300031910 | Soil | VDSDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSV |
Ga0306923_123967631 | 3300031910 | Soil | VSSDSGSRRHAFRSLAGNGALVRVLTGYLLFVLTEYSVWIAML |
Ga0306921_102695253 | 3300031912 | Soil | VGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTEYSAWIAVLVFAYSRGG |
Ga0306921_114249012 | 3300031912 | Soil | MSSDSGGRRRRAFRSLAGNRALVRVLAGYALFVLTEYAVWIAML |
Ga0306921_120688711 | 3300031912 | Soil | VDSDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVW |
Ga0310912_108996551 | 3300031941 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLAEYSVWIAMLVY |
Ga0306922_111369172 | 3300032001 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVYAYS |
Ga0318562_104815722 | 3300032008 | Soil | MGSDSGGRRWHAFRSLAGNSALLRVLAGYVLFTLTEYSVWIAMLVYAYSR |
Ga0318563_101380192 | 3300032009 | Soil | VGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTE |
Ga0318559_100403144 | 3300032039 | Soil | VGGDSGGRRLHAFRSLAGNRALLSVLAAYVMFILAEYAAWIA |
Ga0318556_102612242 | 3300032043 | Soil | VGSDSSGRRWRAFRSLAGNSALLRVLAGYVLFTLTEYSVWIA |
Ga0318504_101054592 | 3300032063 | Soil | VDSDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAMLVYAYG |
Ga0318510_102996502 | 3300032064 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSV |
Ga0318513_103999331 | 3300032065 | Soil | VDTDSGGRRRHAFRSLAGNRVLLRVLVGYGLFVLTEYSVWIAMLVYAYG |
Ga0318514_103369822 | 3300032066 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVY |
Ga0318524_103449291 | 3300032067 | Soil | VAGDSGERRLSAFRSLASSSALLRVLAAYVMFILTEYAVWI |
Ga0318553_101099153 | 3300032068 | Soil | VSSDSGSRRHAFRSLAGNGALVRVLTGYLLFVLTEYSVWIAMLVFAYS |
Ga0306924_115107072 | 3300032076 | Soil | VGGDSGVGRLHAFRSLVANKALLRVLGGYALFTLTEYSVWIAILVYAYSRGGA |
Ga0306924_115590153 | 3300032076 | Soil | VKTSRHRLRAFSSLAGNRALLRVLAAYLLFILTEYAVWIAMLVFA |
Ga0306920_1029368871 | 3300032261 | Soil | VKTSRHRLRAFSSLAGNRALLRVLAAYLLFILTEYAVWIAM |
Ga0335082_115364891 | 3300032782 | Soil | VGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTEY |
Ga0335080_100912084 | 3300032828 | Soil | MGDDRSGRRRRAFGSLAGNTALLRVLAAYLLFILTEYAV |
Ga0335075_104836782 | 3300032896 | Soil | MSGGRSQRAFSSLAGNGALLRVLTAYLLFTLTENAVW |
Ga0335071_110836682 | 3300032897 | Soil | MGGDSGGRLHAFRSLAGNRALVRVLAGYALFVLTEYSAWIAI |
Ga0335083_114998471 | 3300032954 | Soil | VGDGSSARRLYTFHSLAANRALLRVLGGYGLFVLTEYAVWIA |
Ga0335077_115581852 | 3300033158 | Soil | VGGDSGGRRLHAFRSLAGNRALMRVLGGYALFILTECAVWLAMIIFA |
Ga0310914_100518591 | 3300033289 | Soil | VGGGRGGRRRHAFRSLAGNRALVRVLGGYALFILTECAVWIA |
Ga0318519_101254411 | 3300033290 | Soil | VLVGSDSGSRRHAFRSLAGNRALLRVLAGYGLFVLTEYSVWIGML |
Ga0314865_148090_494_622 | 3300033806 | Peatland | MGGNSGGRLHAFRSLTGNRALVRVLTGYALFVLTEYSAWIAVL |
Ga0372943_0976188_449_562 | 3300034268 | Soil | VRDDSGGRRLRAFRSLAGNRALLRVLAAYLLFILTEYA |
⦗Top⦘ |