NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092527

Metagenome / Metatranscriptome Family F092527

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092527
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence MARYMRTYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 91.59 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.551 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.907 % of family members)
Environment Ontology (ENVO) Unclassified
(23.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.383 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 0.00%    Coil/Unstructured: 83.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01041DegT_DnrJ_EryC1 50.47
PF01261AP_endonuc_2 15.89
PF02894GFO_IDH_MocA_C 11.21
PF01408GFO_IDH_MocA 4.67
PF00174Oxidored_molyb 1.87
PF00933Glyco_hydro_3 0.93
PF00072Response_reg 0.93
PF07729FCD 0.93
PF07690MFS_1 0.93
PF00496SBP_bac_5 0.93
PF00324AA_permease 0.93
PF07355GRDB 0.93
PF00078RVT_1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 50.47
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 50.47
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 50.47
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 50.47
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 50.47
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 50.47
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 11.21
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 1.87
COG3915Uncharacterized conserved proteinFunction unknown [S] 1.87
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.93
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.93
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.93
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.93
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.93
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.93
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.55 %
UnclassifiedrootN/A36.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002908|JGI25382J43887_10023320All Organisms → cellular organisms → Bacteria3313Open in IMG/M
3300003505|JGIcombinedJ51221_10126883All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300004092|Ga0062389_103090379All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300004463|Ga0063356_106292964All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300004473|Ga0068919_1141127All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300004635|Ga0062388_102808025All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005467|Ga0070706_100881141All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005542|Ga0070732_10247772All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300005557|Ga0066704_10812582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales581Open in IMG/M
3300005564|Ga0070664_101721316All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005921|Ga0070766_11190488All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006028|Ga0070717_10372624All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300006028|Ga0070717_10393215All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300006041|Ga0075023_100154698All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300006059|Ga0075017_100003095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10461Open in IMG/M
3300006086|Ga0075019_10288418All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006102|Ga0075015_101007272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes510Open in IMG/M
3300006162|Ga0075030_101386118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes551Open in IMG/M
3300006174|Ga0075014_100487571All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300006871|Ga0075434_100555497All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300007265|Ga0099794_10008262All Organisms → cellular organisms → Bacteria4315Open in IMG/M
3300009162|Ga0075423_10369495All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300009176|Ga0105242_10404092All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300010361|Ga0126378_11002291Not Available939Open in IMG/M
3300011270|Ga0137391_11152377Not Available623Open in IMG/M
3300012202|Ga0137363_10608721Not Available922Open in IMG/M
3300012285|Ga0137370_10750426All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012977|Ga0134087_10080971All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP11331Open in IMG/M
3300014495|Ga0182015_10846956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300014501|Ga0182024_12947252Not Available503Open in IMG/M
3300014654|Ga0181525_10078567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1839Open in IMG/M
3300015359|Ga0134085_10079536Not Available1343Open in IMG/M
3300015373|Ga0132257_100587131All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300016387|Ga0182040_11258279Not Available624Open in IMG/M
3300016445|Ga0182038_10559073Not Available983Open in IMG/M
3300017930|Ga0187825_10008926All Organisms → cellular organisms → Bacteria3354Open in IMG/M
3300017930|Ga0187825_10436752Not Available506Open in IMG/M
3300017933|Ga0187801_10163555Not Available871Open in IMG/M
3300018032|Ga0187788_10054298All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300020579|Ga0210407_10722191Not Available772Open in IMG/M
3300020580|Ga0210403_10129996All Organisms → cellular organisms → Bacteria2053Open in IMG/M
3300020582|Ga0210395_10176268Not Available1601Open in IMG/M
3300020582|Ga0210395_10347949All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300020582|Ga0210395_10626232Not Available807Open in IMG/M
3300021180|Ga0210396_11328246All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300021377|Ga0213874_10312477Not Available594Open in IMG/M
3300021403|Ga0210397_11111802Not Available614Open in IMG/M
3300021405|Ga0210387_11148177All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300021476|Ga0187846_10470632Not Available514Open in IMG/M
3300021478|Ga0210402_11659910Not Available566Open in IMG/M
3300021559|Ga0210409_11716520Not Available504Open in IMG/M
3300022532|Ga0242655_10129048Not Available722Open in IMG/M
3300022724|Ga0242665_10144506All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300023056|Ga0233357_1054568Not Available520Open in IMG/M
3300025934|Ga0207686_11719794All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300025961|Ga0207712_10969003All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300026325|Ga0209152_10385949All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1545Open in IMG/M
3300027824|Ga0209040_10380951Not Available661Open in IMG/M
3300027842|Ga0209580_10186168All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300027898|Ga0209067_10253164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300028020|Ga0265351_1014776All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300029952|Ga0311346_10560417Not Available1038Open in IMG/M
3300030336|Ga0247826_11259843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684594Open in IMG/M
3300030617|Ga0311356_11054026All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300031236|Ga0302324_101349825All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300031446|Ga0170820_11774246Not Available659Open in IMG/M
3300031561|Ga0318528_10091138Not Available1590Open in IMG/M
3300031572|Ga0318515_10789547All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1501Open in IMG/M
3300031715|Ga0307476_10786509Not Available704Open in IMG/M
3300031715|Ga0307476_10941947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300031718|Ga0307474_10950059Not Available680Open in IMG/M
3300031720|Ga0307469_10101492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2022Open in IMG/M
3300031720|Ga0307469_10142999All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300031720|Ga0307469_10692028Not Available923Open in IMG/M
3300031720|Ga0307469_10699454Not Available919Open in IMG/M
3300031720|Ga0307469_10719234Not Available907Open in IMG/M
3300031724|Ga0318500_10187165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300031744|Ga0306918_10609168Not Available856Open in IMG/M
3300031751|Ga0318494_10042351All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300031763|Ga0318537_10289661Not Available606Open in IMG/M
3300031792|Ga0318529_10215730All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1891Open in IMG/M
3300031796|Ga0318576_10236627All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1861Open in IMG/M
3300031819|Ga0318568_10656876All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1652Open in IMG/M
3300031823|Ga0307478_10884278All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300031823|Ga0307478_11033042Not Available686Open in IMG/M
3300031835|Ga0318517_10494757All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1551Open in IMG/M
3300031859|Ga0318527_10213862Not Available817Open in IMG/M
3300031896|Ga0318551_10622380All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1623Open in IMG/M
3300031964|Ga0311373_11409663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300032008|Ga0318562_10539778All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300032009|Ga0318563_10537537All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300032035|Ga0310911_10052037All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300032044|Ga0318558_10354381Not Available728Open in IMG/M
3300032052|Ga0318506_10493182Not Available543Open in IMG/M
3300032076|Ga0306924_10681565Not Available1156Open in IMG/M
3300032089|Ga0318525_10366096All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1739Open in IMG/M
3300032160|Ga0311301_10783146Not Available1315Open in IMG/M
3300032180|Ga0307471_100315522All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300032261|Ga0306920_100642040All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300032261|Ga0306920_100888569All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300032828|Ga0335080_10971986Not Available866Open in IMG/M
3300033289|Ga0310914_10003603All Organisms → cellular organisms → Bacteria10675Open in IMG/M
3300033289|Ga0310914_10778675All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1854Open in IMG/M
3300033416|Ga0316622_101845624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300034065|Ga0334827_046190Not Available1627Open in IMG/M
3300034163|Ga0370515_0154267All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300034163|Ga0370515_0217115Not Available813Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil10.28%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.93%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.93%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004473Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031964III_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25382J43887_1002332013300002908Grasslands SoilQMARYMRHYPLREFVTHHFALRDVDAAVRKSIAPDSMKVVIEPWA*
JGIcombinedJ51221_1012688323300003505Forest SoilRYMKVYPLRKFVSHRFPLRDVEAAVHKSIAGDSMKVVIAPWS*
Ga0062389_10309037913300004092Bog Forest SoilRQMARYMQRYPLREFVSHRFPLRDVEAAVHKSVASDSMKVAIMPWA*
Ga0063356_10629296413300004463Arabidopsis Thaliana RhizosphereYGPSLRQMARYMRHYPLREFVSHRYGLDAVETAVNQAIAPDSMKVVIDPWT*
Ga0068919_114112713300004473Peatlands SoilKHYPLREFVSHRYPLREVETAVQKAIAPDSMKVVIEPWA*
Ga0062388_10280802523300004635Bog Forest SoilAAYAPSMRQMARYMRHYPLRDFVSHRFPLRGVEAAMEKSIAPDSMKVIMEPWT*
Ga0070706_10088114123300005467Corn, Switchgrass And Miscanthus RhizosphereMARYMRNYPLREFVSHRFALRDVEAAVRKSIAPDSMKVAIAPWA*
Ga0070732_1024777223300005542Surface SoilNYPLREFVSHRFPLRDVEAAVHKSIAPDSMKVAIAPWS*
Ga0066704_1081258223300005557SoilQMARYMQRYPLRSFVSHRYALKDAEAAVRKSMAPDSMKVVIEPWA*
Ga0070664_10172131623300005564Corn RhizosphereREFVSHRYGLDAVETAVNQAIAPDSMKVVIDPWT*
Ga0070766_1119048823300005921SoilYMQDYPLREFVSHRFPLRDVEAAVHKSVAPDSMKVAIVPWS*
Ga0070717_1037262433300006028Corn, Switchgrass And Miscanthus RhizosphereLRYMRQYPVREFVSHRCRLDDVDAAVKQSIASDSMKVVIDPWA*
Ga0070717_1039321523300006028Corn, Switchgrass And Miscanthus RhizosphereGPSMRQMTRYMQNYPLREFVTHRFPLRDVEEAVHKSVAADSMKVAIVPWS*
Ga0075023_10015469823300006041WatershedsYMQTYPLCEFVSHRFPLRDVEAAVHKSVSPDSMKVAIEPWA*
Ga0075017_10000309513300006059WatershedsYPLREFVSHRFPLRDVEAAVHKSVAPDSMKVAIEPWS*
Ga0075019_1028841813300006086WatershedsYMNTYPLRDFVSHRFPLRDVEAAVHKAVAPDSMKVAIMPWA*
Ga0075015_10100727213300006102WatershedsYPLREFVSHRYPLREVDTAVLKSIAPDSMKVAIAPWS*
Ga0075030_10138611823300006162WatershedsMNTYPLRDFVSHRFPLRDVEAAVHKAVAPDSMKVAIMPWA*
Ga0075014_10048757113300006174WatershedsMNHYPLREFVSHRFPLRDVEAAVQKSVAPDSMKVAIAPWA*
Ga0075434_10055549713300006871Populus RhizospherePLREFVSHRYPLRKVEEAVHKSIAPDSMKVVIEPWA*
Ga0099794_1000826213300007265Vadose Zone SoilREFVSHRYRLNDTDAAVQKAIAPDSMKVVIDPWA*
Ga0075423_1036949513300009162Populus RhizosphereLRQMARYMRHYPLREFVSHRYGLEAVETAVNQAIAPDSMKVVIDPWT*
Ga0105242_1040409233300009176Miscanthus RhizosphereARYMRHYPLREFVAHRYGLDAVETAVNQAIAPDSMKVVIDPWT*
Ga0126378_1100229123300010361Tropical Forest SoilGPSMRQMARYMRNYPLREFVSHRFALRDVEAAVHKSIAPDSMKVAIEPWD*
Ga0137391_1115237723300011270Vadose Zone SoilPSMRQMARYMSNYPLREFVSHRFPLRDVEIAVQKSVAPDSMKVAIAPWA*
Ga0137363_1060872123300012202Vadose Zone SoilREFVSHRFPLRDVEAAVQKSVAPDSMKVTIAPWT*
Ga0137370_1075042613300012285Vadose Zone SoilGSSGPSMRQMARYMRQYPLRSFVSHRYALQDAEAAVRKSMAPDSKKVVIEPWA*
Ga0134087_1008097133300012977Grasslands SoilREFVSHRFRLADVDAAIQKSIAADSMKVVIDPWA*
Ga0182015_1084695613300014495PalsaGPSMRQMARYMHVYPLREFVSHRFPLRDVEAAVQKAVAPDSMKVAITPWA*
Ga0182024_1294725223300014501PermafrostLREFVSHHYGLRHVEEAVHKSVAADSMKVVVTPWS*
Ga0181525_1007856723300014654BogMARYMHSYPLREFVSHRFALRDVETAVHKAVAQDSMKVAITPWG*
Ga0134085_1007953623300015359Grasslands SoilPLREFVSHRFPLREVEKAVQKSIAPDSMKVVIEPWA*
Ga0132257_10058713113300015373Arabidopsis RhizosphereQLARYMRHYPVREFVSHRYGLDAVETAVNKAIAPDSMKVVIDPWA*
Ga0182040_1125827913300016387SoilPSMRQMARYMRSYPLREFVSHRFPLREVEAAVHKSIAPDSMKVAIEPWA
Ga0182038_1055907323300016445SoilLRFLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0187825_1000892613300017930Freshwater SedimentMARYMRTYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0187825_1043675213300017930Freshwater SedimentMARYMKHYPLREFVSHRFPLRDVEAAVHQAVASDSMKVAIMPWA
Ga0187801_1016355513300017933Freshwater SedimentMRQMARYMKTHPLREFVSHRFPLRDVEAAVHKSVAPDSMKVVIMPWA
Ga0187788_1005429813300018032Tropical PeatlandMRHYPLSEFVSHRYGLAAVETAVNKAIAPDSMKVVIDPWA
Ga0210407_1072219113300020579SoilPSMRQMARYMKHYALSEFVTHRFPLRDVEAAVNKSVAPDSMKVAIVPWS
Ga0210403_1012999613300020580SoilMRQMARYMKYYPLREFVSHRYPLREVETAVHKAIAPDSMKVVIEPWS
Ga0210395_1017626823300020582SoilQMARYAHNYPLREFVSHRFPLREVEAAVQKAIGPDSMKVAMEPWA
Ga0210395_1034794923300020582SoilYPLREFVSHRFDLHHVESAVLKSVQPDSMKVVIDPWKASPGSHN
Ga0210395_1062623213300020582SoilLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWA
Ga0210396_1132824613300021180SoilSMRQMARYMKHYPLRDFVSHRFPLRGVEAAMEKSIALDSMKVVMEPWS
Ga0213874_1031247713300021377Plant RootsARYMNQYPLRDFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0210397_1111180223300021403SoilRYMHTYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWA
Ga0210387_1114817723300021405SoilRYLKHYPLREFVSHRYGLRDVEAAVHKAIDPDSMKVVLEPWK
Ga0187846_1047063213300021476BiofilmASYGPSLRQMARYQRIYPLRQFVSHRFALRDVEAAVRKSIAPDSMKVAIDPWA
Ga0210402_1165991013300021478SoilSMRQMARYMQHYPLSEFVTHRFPLRDVEAAVNKSVAPDSMKVAIVPWS
Ga0210409_1171652013300021559SoilMARYLRSYPLREFVSHRFPLRDVEAAVQKSIAPDSMKVAIAPWA
Ga0242655_1012904813300022532SoilLGVGGEEPASYGPSLRQMARYMKRYPLQEFVSHRYPLREVEAAVHKSIAPDSMKVAVAPW
Ga0242665_1014450623300022724SoilYMKYYPLREFVSHRYPLREVEAAVHKAIAPDSMKVVIEPWS
Ga0233357_105456823300023056SoilHYPLREFVSHRFPLRDVEAAVQKSIAPDSMKVAIAPWS
Ga0207686_1171979413300025934Miscanthus RhizosphereHYPLREFVAHRYGLDAVETAVNQAIAPDSMKVVIDPWT
Ga0207712_1096900313300025961Switchgrass RhizosphereGPSLRQMARYMRHYPLREFVSHRYGLDAVETAVNQAIAPDSMKVVIDPWT
Ga0209152_1038594913300026325SoilVREFVSHRCRLDDVDAAVKQSIASDSMKVVIDPWA
Ga0209040_1038095123300027824Bog Forest SoilNYPLREFVSHRFPLHEVEAAVQKSIAPDSMKVTIAPWA
Ga0209580_1018616813300027842Surface SoilMRQMARYMKHYPLREFVSHRYPLRDVETAVHKAIAPDSMKVVIEPWK
Ga0209067_1025316423300027898WatershedsYMNTYPLRDFVSHRFPLRDVEAAVHKAVAPDSMKVAIMPWA
Ga0265351_101477613300028020SoilQHYPLEEFITHKFGLQDVDAAVQKSIAPDSMKVVIDPWAM
Ga0311346_1056041723300029952BogYMTTYPLREFVSHRFPLRDVEVAVQQSVAADSMKVAIMPWD
Ga0247826_1125984323300030336SoilHYPLREFVSHRFGLDAVETAVNKAIAPDSMKVVIDPWT
Ga0311356_1105402613300030617PalsaHYPLRDFVSHRFPLRGVEAAMEKSIAPDSMKVIMEPWS
Ga0302324_10134982513300031236PalsaLRDFVTHRFPLRGVEAAMEKSIAPDSMKVIMEPWS
Ga0170820_1177424623300031446Forest SoilGPSMRQMARYMQNYPLREFVTHRFPLRDVEEAVHKSVAADSMKVAIVPWS
Ga0318528_1009113813300031561SoilPASYGPSLRQMVRDMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318515_1078954713300031572SoilHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0307476_1078650913300031715Hardwood Forest SoilMRQMARYMQNYPLREFVSHRFPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0307476_1094194723300031715Hardwood Forest SoilGPSMRQMARYMHVYPLREFVSHRFPLRDVEAAVHKAVAADSMKVAITPWG
Ga0307474_1095005913300031718Hardwood Forest SoilSMRQMARYMQNYPLREFVTHRFPLRDVEEAVHKSVAADSMKVAIVPWS
Ga0307469_1010149233300031720Hardwood Forest SoilYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0307469_1014299933300031720Hardwood Forest SoilSLRQLARYMRHYPLRDFVSHRYGLDAVETAVNKAIAPDSMKVVIDPWA
Ga0307469_1069202813300031720Hardwood Forest SoilRYMRTYPLGEFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0307469_1069945413300031720Hardwood Forest SoilHYPLREFVSHRFPLREVETAVHKAIAQDSMKVVIEPWA
Ga0307469_1071923423300031720Hardwood Forest SoilPLREFVTHRYPLREVEAAVHKSIAPDSMKVAIAPWS
Ga0318500_1018716513300031724SoilEPASYGPSMRQMLRYLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0306918_1060916823300031744SoilRQMARYMRSYPLREFVSHRFPLREVEAAVHKSIAPDSMKVAIEPWA
Ga0318494_1004235113300031751SoilRQMARYMRHYPLREFVSHRYPLHEVTAAMERAMAPDSMKVAIDPWA
Ga0318537_1028966123300031763SoilVGGEEPASYGPSLRQMVRYMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318529_1021573013300031792SoilGGEEPASYGPSMRQMLRYLRHYPALRKFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0318576_1023662713300031796SoilLRYLRHYPTLREFVSHRFALRDVQAAVEKSIAPDSIKVVIDPWR
Ga0318568_1065687623300031819SoilLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0307478_1088427823300031823Hardwood Forest SoilMKHYPLREFVSHRYPLREVETAVHKAIAPDSMKVVIEPWS
Ga0307478_1103304223300031823Hardwood Forest SoilRQMARYMQNYPLREFVSHRFPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318517_1049475713300031835SoilYGPSMRQMLRFLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0318527_1021386213300031859SoilHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318551_1062238023300031896SoilGGEEPASYGPSMRQMLRYLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0311373_1140966323300031964PalsaKHYPLRDFVSHRFPLRGVEAAMEKSIAPDSMKVIMEPWS
Ga0318562_1053977813300032008SoilHYPLREFVSHRYPLHEVTAAMERAMAPDSMKVAIDPWA
Ga0318563_1053753713300032009SoilYMRHYPLREFVSHRYPLHEVTAAMERAMAPDSMKVAIDPWA
Ga0310911_1005203733300032035SoilGGEEPASYGPSLRQMVRYMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318558_1035438123300032044SoilEEPASYGPSLRQMVRYMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0318506_1049318213300032052SoilVRYMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0306924_1068156513300032076SoilYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0318525_1036609623300032089SoilRQMLRYLRHYPALRKFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0311301_1078314623300032160Peatlands SoilMRQMARYMGTYPLREFVSHRFPLREVEAAVHKSVAPDSMKVAIMPWT
Ga0307471_10031552213300032180Hardwood Forest SoilNYPLREFVTHRFPLRDVEEAVHKSVAADSMKVAIVPWS
Ga0306920_10064204033300032261SoilYLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0306920_10088856913300032261SoilGPSMRQMARYMRFYPLREFVSHRYSLQAVETAVKKSMAADSMKVVIEPWA
Ga0335080_1097198623300032828SoilRYMKTYPLREFVSHRFPLRDVEAAVHKSVAPDSMKVAIEPWS
Ga0310914_1000360313300033289SoilGPSLRQMVRYMKHYPLREFVSHRYPLRDVEAAVHKSIAPDSMKVAIAPWS
Ga0310914_1077867523300033289SoilPASYGPSMRQMLRFLRHYPALREFVSHRYALRDAQAAVEKSIAPDSIKVVIDPWR
Ga0316622_10184562413300033416SoilSLRQMARYMRHYPLRQFVTHRYGLADVAAAMNQAIAPDSLKVAIDPWA
Ga0334827_046190_3_1223300034065SoilTTYPLREFVSHRFPLRDVEVAVQQSVAADSMKVAIMPWD
Ga0370515_0154267_767_8893300034163Untreated Peat SoilMKHYPLRDFVTHRFPLRGVQAAMEKSIAPDSMKVIMEPWT
Ga0370515_0217115_3_1223300034163Untreated Peat SoilEHYPLREFVSHHYGLRDVEEAVHKSVAPDSMKVVVTPWN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.