Basic Information | |
---|---|
Family ID | F092480 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 45 residues |
Representative Sequence | FFVFVAGIAADLLETRHRQLVQAAVWGLLVANAAWHLWELARAGRG |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.94 % |
% of genes near scaffold ends (potentially truncated) | 97.20 % |
% of genes from short scaffolds (< 2000 bps) | 87.85 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.589 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.280 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.234 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF05960 | DUF885 | 4.67 |
PF07690 | MFS_1 | 3.74 |
PF13561 | adh_short_C2 | 1.87 |
PF00106 | adh_short | 0.93 |
PF07883 | Cupin_2 | 0.93 |
PF13620 | CarboxypepD_reg | 0.93 |
PF12006 | DUF3500 | 0.93 |
PF13396 | PLDc_N | 0.93 |
PF03989 | DNA_gyraseA_C | 0.93 |
PF12679 | ABC2_membrane_2 | 0.93 |
PF00521 | DNA_topoisoIV | 0.93 |
PF13419 | HAD_2 | 0.93 |
PF00069 | Pkinase | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 4.67 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.74 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 1.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.59 % |
Unclassified | root | N/A | 8.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10238900 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 592 | Open in IMG/M |
3300000891|JGI10214J12806_11629026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300004479|Ga0062595_102381766 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005166|Ga0066674_10120671 | Not Available | 1226 | Open in IMG/M |
3300005171|Ga0066677_10088347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1622 | Open in IMG/M |
3300005334|Ga0068869_100265933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
3300005364|Ga0070673_101823057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300005439|Ga0070711_101539706 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005538|Ga0070731_10473914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300005546|Ga0070696_100407861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
3300005552|Ga0066701_10073423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1944 | Open in IMG/M |
3300005559|Ga0066700_10252405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
3300005560|Ga0066670_10173767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1277 | Open in IMG/M |
3300005561|Ga0066699_10339432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
3300005568|Ga0066703_10151701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1392 | Open in IMG/M |
3300005586|Ga0066691_10532310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300005591|Ga0070761_10836115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300005718|Ga0068866_10047129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
3300006050|Ga0075028_100213718 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300006175|Ga0070712_100805683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300006176|Ga0070765_101615534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 609 | Open in IMG/M |
3300006237|Ga0097621_100276765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1476 | Open in IMG/M |
3300006358|Ga0068871_101296915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300009012|Ga0066710_100429891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1975 | Open in IMG/M |
3300009098|Ga0105245_10234263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1777 | Open in IMG/M |
3300009101|Ga0105247_10474883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300009143|Ga0099792_10379994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300010325|Ga0134064_10038266 | Not Available | 1435 | Open in IMG/M |
3300010358|Ga0126370_11801305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300010361|Ga0126378_12992831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300011119|Ga0105246_10438804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300011269|Ga0137392_10018112 | All Organisms → cellular organisms → Bacteria | 4878 | Open in IMG/M |
3300011270|Ga0137391_10308930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
3300012096|Ga0137389_10622938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300012208|Ga0137376_10160700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
3300012211|Ga0137377_10295151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1555 | Open in IMG/M |
3300012357|Ga0137384_11008873 | Not Available | 669 | Open in IMG/M |
3300012901|Ga0157288_10315508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300012929|Ga0137404_11473197 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300012930|Ga0137407_10050563 | All Organisms → cellular organisms → Bacteria | 3372 | Open in IMG/M |
3300012930|Ga0137407_10252830 | Not Available | 1598 | Open in IMG/M |
3300012958|Ga0164299_10988168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300012960|Ga0164301_10368576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
3300012960|Ga0164301_11288534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300012984|Ga0164309_10080303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1997 | Open in IMG/M |
3300013297|Ga0157378_10370760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1403 | Open in IMG/M |
3300013297|Ga0157378_10418767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
3300014968|Ga0157379_10756808 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300015052|Ga0137411_1139627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300015357|Ga0134072_10045610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
3300015373|Ga0132257_101427504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300017924|Ga0187820_1021325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
3300017930|Ga0187825_10032110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
3300017933|Ga0187801_10424617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
3300017943|Ga0187819_10059734 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2265 | Open in IMG/M |
3300017947|Ga0187785_10107938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
3300017955|Ga0187817_10862384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 579 | Open in IMG/M |
3300017972|Ga0187781_11056368 | Not Available | 595 | Open in IMG/M |
3300018006|Ga0187804_10034031 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1931 | Open in IMG/M |
3300018043|Ga0187887_10184343 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300018071|Ga0184618_10215883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300018433|Ga0066667_10113652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1833 | Open in IMG/M |
3300018433|Ga0066667_10278301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
3300018433|Ga0066667_10670139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
3300019361|Ga0173482_10054174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
3300020579|Ga0210407_10449566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
3300020579|Ga0210407_11332332 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 535 | Open in IMG/M |
3300021080|Ga0210382_10231896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300021178|Ga0210408_11045380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300021401|Ga0210393_10600259 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300021404|Ga0210389_11221373 | Not Available | 578 | Open in IMG/M |
3300021420|Ga0210394_10373696 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300021433|Ga0210391_10126481 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2012 | Open in IMG/M |
3300021433|Ga0210391_10336267 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300021477|Ga0210398_10252667 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300021559|Ga0210409_10899551 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300025912|Ga0207707_11666132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300025915|Ga0207693_11006324 | Not Available | 636 | Open in IMG/M |
3300025916|Ga0207663_10022350 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
3300025916|Ga0207663_10581105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300025942|Ga0207689_11037829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300026121|Ga0207683_10099026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2602 | Open in IMG/M |
3300026291|Ga0209890_10099952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
3300026298|Ga0209236_1073781 | Not Available | 1604 | Open in IMG/M |
3300026310|Ga0209239_1346632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300026524|Ga0209690_1021555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3247 | Open in IMG/M |
3300026538|Ga0209056_10091931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2510 | Open in IMG/M |
3300026552|Ga0209577_10504150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
3300027684|Ga0209626_1027104 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300027824|Ga0209040_10399306 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300027855|Ga0209693_10632472 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300027869|Ga0209579_10323248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300027889|Ga0209380_10006667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6911 | Open in IMG/M |
3300027905|Ga0209415_10303305 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300028047|Ga0209526_10566235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300028906|Ga0308309_10840981 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300029636|Ga0222749_10315161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300031122|Ga0170822_11317511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300031446|Ga0170820_15630239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1535 | Open in IMG/M |
3300031726|Ga0302321_101507083 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 775 | Open in IMG/M |
3300031823|Ga0307478_11113219 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300031962|Ga0307479_11105082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
3300032160|Ga0311301_10143301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4363 | Open in IMG/M |
3300032770|Ga0335085_10172360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2684 | Open in IMG/M |
3300032898|Ga0335072_10618866 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300034090|Ga0326723_0127993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.28% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_102389002 | 3300000567 | Peatlands Soil | AGIAADLLETPQRPLVAASVWGLLLANALWNLWQLARVGRG* |
JGI10214J12806_116290262 | 3300000891 | Soil | ADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0062595_1023817661 | 3300004479 | Soil | PFLFVFVAGIAADLLETRYHQIAVAVIAGLLVANAAWNLWELARIG* |
Ga0066674_101206712 | 3300005166 | Soil | LVAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAGWNLWELARAGS* |
Ga0066677_100883471 | 3300005171 | Soil | FLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0068869_1002659333 | 3300005334 | Miscanthus Rhizosphere | FVAGIAADLLETRYHEIAVAAIAGLLVANALWNLWELARIS* |
Ga0070673_1018230572 | 3300005364 | Switchgrass Rhizosphere | AGIAADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0070711_1015397061 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LFVFVAGILADLLETPQRMLVAATISGLLSASALLSLLELARVTRG* |
Ga0070731_104739141 | 3300005538 | Surface Soil | LGFQFMALPFVFVFVAGIAADLVETRYREIALASIWGLLAANAAWSLWELARTG* |
Ga0070696_1004078611 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVAGIAADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0066701_100734233 | 3300005552 | Soil | VAGIAADLLESRHKNLVTACVWGLLLANAGWNLWELARAGS* |
Ga0066700_102524051 | 3300005559 | Soil | AVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0066670_101737672 | 3300005560 | Soil | DLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0066699_103394322 | 3300005561 | Soil | IAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0066703_101517012 | 3300005568 | Soil | VAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNVWELARAGS* |
Ga0066691_105323101 | 3300005586 | Soil | QLMAVPFLFVFVGGIAADLLETRYRQLVLASVWGLLVANAAWNVWELARAGRG* |
Ga0070761_108361151 | 3300005591 | Soil | ALPFLFVFVAGVSADLLETRHRSLVMGCIWGMLMAQSIWNLWELAGIGRG* |
Ga0068866_100471291 | 3300005718 | Miscanthus Rhizosphere | VFVAGIAADLLETRHRPIVMAAVWSLLVANAAWSLWELARVA* |
Ga0081540_12071352 | 3300005983 | Tabebuia Heterophylla Rhizosphere | PFLFVFIAGIAADLLETAQRGLVLSCLLGLLIANGVWNVWELARAGR* |
Ga0075028_1002137182 | 3300006050 | Watersheds | FVFVAGIAADLLETGKRSWVMAAVWGVLLANFLWNWAELAGWSRP* |
Ga0070712_1008056832 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LFVFVAGIAADLLETRYHEIAVAAIAGLLVANALWNLWELARIS* |
Ga0070765_1016155341 | 3300006176 | Soil | ADLLETRHRELVKACVWGLLLANAFWNLAELARVGRPF* |
Ga0097621_1002767653 | 3300006237 | Miscanthus Rhizosphere | DLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0068871_1012969152 | 3300006358 | Miscanthus Rhizosphere | FLFVFVAGIAADLLETRHRPIVMAAVWSLLVANAAWSLWELARVA* |
Ga0066710_1004298911 | 3300009012 | Grasslands Soil | IAADLLESGHKNLVTACVWGLLVANAAWNVWELARAGS |
Ga0105245_102342631 | 3300009098 | Miscanthus Rhizosphere | AVPFLFVFVAGITADLLETPQRGLVLSCILGLLGANGIWNLWELARASAG* |
Ga0105247_104748832 | 3300009101 | Switchgrass Rhizosphere | FVFVAGIAADLLETRYHEIAVAAIAGLLVANAAWNLWELARIS* |
Ga0099792_103799941 | 3300009143 | Vadose Zone Soil | LGFEFMAVPFRFVFVAGIAADLLETRYHQIAVAAIAGLLVANAAWNLWELARIG* |
Ga0134064_100382661 | 3300010325 | Grasslands Soil | ADLLESRHKNLVTASVWGLLVANAAWNVWELARAGS* |
Ga0126370_118013052 | 3300010358 | Tropical Forest Soil | AGIAADLLETGHRALVLACVWALLLANAAWNLRGLGAAGGHYFQ* |
Ga0126378_129928311 | 3300010361 | Tropical Forest Soil | ADMLESRHRNLVTACVWGLLVAHAGWNIWELARARS* |
Ga0105246_104388042 | 3300011119 | Miscanthus Rhizosphere | FVAGIAADLLETRHRQIALAAILGLLVASAAWNLWELARVG* |
Ga0137392_100181121 | 3300011269 | Vadose Zone Soil | LFVFVAGVAADLLETRHRQLVQAAVWGLLVANAGWHVWELARAGRG* |
Ga0137391_103089303 | 3300011270 | Vadose Zone Soil | MAVPFLFVFVAGVAADLLETRHREIALAAIWGLLVANAGWNLWELARIG* |
Ga0137389_106229381 | 3300012096 | Vadose Zone Soil | FEFMAVPFLFVFVAGIAADLLQTRYHQIAVAAIAGLLVANAAWNLWELARIG* |
Ga0137376_101607003 | 3300012208 | Vadose Zone Soil | VAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0137377_102951511 | 3300012211 | Vadose Zone Soil | LVAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0137384_110088731 | 3300012357 | Vadose Zone Soil | GIAADLLETQQRGLVLACIFGLLVANGVWNVWELARARIG* |
Ga0157288_103155082 | 3300012901 | Soil | FQFIAVPFLFVFVAGIAADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0137404_114731972 | 3300012929 | Vadose Zone Soil | LVFVAGIAADLLESRHHQIALAAVCGLILANAAWNLWELARVG* |
Ga0137407_100505636 | 3300012930 | Vadose Zone Soil | FEFMAVPFLFVFVAGIAADLLETRYHQIAVAAIAGLLVANAAWNLWELARIG* |
Ga0137407_102528303 | 3300012930 | Vadose Zone Soil | VFVAGIAADLIESGHKNLVTACVWGLLVANAAWNVWALARAGS* |
Ga0164299_109881682 | 3300012958 | Soil | FVAGIAADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA* |
Ga0164301_103685762 | 3300012960 | Soil | MAIPFLFVFVAGIAADLLETRFRQLAQAAVWGLLVANAAWHLWELARAGRG* |
Ga0164301_112885342 | 3300012960 | Soil | VFVAGIAADLLETRHRPIVMVAVWSLLVANAAWSLWELARVA* |
Ga0164309_100803033 | 3300012984 | Soil | FVAGIAADLLETRHRQVVMAAVWSLLLANAAWSLWELARVA* |
Ga0157378_103707603 | 3300013297 | Miscanthus Rhizosphere | FLFVFVAGIAADLLETRYHEIAVAAIAGLLVANALWNLWELARIS* |
Ga0157378_104187673 | 3300013297 | Miscanthus Rhizosphere | VPFLFVFVAGIAADLLETRHRPIVMAAVWSLLVANAAWSLWELARVA* |
Ga0157379_107568081 | 3300014968 | Switchgrass Rhizosphere | VAGITADLLETPQRNLVFSCILGLLVANGIWNLWELTRASAG* |
Ga0137411_11396272 | 3300015052 | Vadose Zone Soil | GFQLIVMPFLLVFVAGISADLLETSHRNLVMACLWGLLTANAIWNLAELGRA* |
Ga0134072_100456102 | 3300015357 | Grasslands Soil | VFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG* |
Ga0132257_1014275042 | 3300015373 | Arabidopsis Rhizosphere | FFVFVAGIAADLLETRHRQLVQAAVWGLLVANAAWHLWELARAGRG* |
Ga0187820_10213253 | 3300017924 | Freshwater Sediment | FVFVAGIAADLLETRFREIVLASIWGLLVANAAWNLWELARVV |
Ga0187825_100321103 | 3300017930 | Freshwater Sediment | GIAADLIETRQRPVALAAVWALLLANAAWNLWELARAGRG |
Ga0187801_104246172 | 3300017933 | Freshwater Sediment | GIAADLLETRQRELVKACVWGLLLANAFWNLAELARVGRPF |
Ga0187819_100597343 | 3300017943 | Freshwater Sediment | AADLLETRQRDPVKACVWGLLVANALWNLAELARVGRPLAP |
Ga0187785_101079383 | 3300017947 | Tropical Peatland | AADLLESRHRQLVQAAIWGLLVANAVWHVWELARAGRG |
Ga0187817_108623842 | 3300017955 | Freshwater Sediment | AGIAADLLETPQRDLVMACVWGLVVANALWNLAELARVGRPL |
Ga0187781_110563681 | 3300017972 | Tropical Peatland | LIALPFLVVFVAGVVADLIETRQRSLVTAFVIGLLSANALWNLVELSRVGRG |
Ga0187804_100340311 | 3300018006 | Freshwater Sediment | LVFVAGVAADLLETSQRHLVMACVWGVLVANALWNLVELARVGRT |
Ga0187887_101843432 | 3300018043 | Peatland | VFVAAIASDMLETQRRDLVAACVWGLLLANAFWNLAELARVGKPL |
Ga0184618_102158832 | 3300018071 | Groundwater Sediment | VAVPFLLVFVAGISADLLETRHRNLVLACLWGLLTANALWNLAELARA |
Ga0066667_101136523 | 3300018433 | Grasslands Soil | VAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG |
Ga0066667_102783013 | 3300018433 | Grasslands Soil | VAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNVWELARAGS |
Ga0066667_106701392 | 3300018433 | Grasslands Soil | VAVRFLFVFVAGVAADLLETRSRNLVIACLWGLLGANALWSLMELARVPQV |
Ga0173482_100541742 | 3300019361 | Soil | FVAGIAADLLETRHRQVVMAAVWGLLVANAAWSLWELARVA |
Ga0210407_104495663 | 3300020579 | Soil | ADLLETPRRELVMACVWGLLLANALWNLAELARVGRPL |
Ga0210407_113323321 | 3300020579 | Soil | ADLLESGQRSWVMACVWGLLLANALWNLAELARWGRV |
Ga0210382_102318962 | 3300021080 | Groundwater Sediment | FQLVAVPFLLVFVAGISADLLETRHRNLVLACLWGLLTANALWNLAELARA |
Ga0210408_110453802 | 3300021178 | Soil | VAVPFLFVFVSGIAADLVETRHREIALAAIWGLLVANAGWNLWELARIG |
Ga0210393_106002591 | 3300021401 | Soil | AAVASDMLETQRRDLIAACVWGLLLANAFWNLAELARVGKPL |
Ga0210389_112213731 | 3300021404 | Soil | FWFVFVAAIAADLLETQKRDLVLAFVWGLLVANALWNLGELARLAKHV |
Ga0210394_103736961 | 3300021420 | Soil | LFVFVAGIAADLLETPRRDLVTACVWGLLLANALWNLAELARVGRPL |
Ga0210391_101264813 | 3300021433 | Soil | FVFVAGIAADLLETRHHDLIMACVWGLLLANALWNLAELARVGLSS |
Ga0210391_103362672 | 3300021433 | Soil | FVAGITADLLETRHRELVKACVWGLLLANAFWNLAELARVGRPF |
Ga0210398_102526671 | 3300021477 | Soil | VFVAAIASDMLETPRRDLVAACVWGLLLANAFWNLAELARVGKPL |
Ga0210409_108995512 | 3300021559 | Soil | FVFVAGIAADLLETRHRELVKACVWGLLLANAFWNLAELARVGRPF |
Ga0207707_116661322 | 3300025912 | Corn Rhizosphere | LFVFVAGIAADLLETRHRPIVMAAVWSLLVANAAWSLWELARVA |
Ga0207693_110063242 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GIAADLLETRYHEIAVAAIAGLLVANALWNLWELARIS |
Ga0207663_100223506 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVTADLLETRCRQLVQAGITGLLLANAAWNVWELTRAGRG |
Ga0207663_105811051 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AADLLETRHRQIALAAILGLLVASAAWNLWELARVG |
Ga0207689_110378291 | 3300025942 | Miscanthus Rhizosphere | FVAGIAADLLETRYHEIAVAAIAGLLVANALWNLWELARIS |
Ga0207683_100990261 | 3300026121 | Miscanthus Rhizosphere | AVPFLFVFVAGIAADLLETRHRPIVMAAVWSLLVANAAWSLWELARVA |
Ga0209890_100999522 | 3300026291 | Soil | LNVWQGLLVFVAGIAADLLETRYREIALAAIWGLLVASAAWNLWELGRVG |
Ga0209236_10737811 | 3300026298 | Grasslands Soil | FQLVAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAGWNLWELARAGS |
Ga0209239_13466321 | 3300026310 | Grasslands Soil | LFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG |
Ga0209690_10215554 | 3300026524 | Soil | VFVAGIAADLLESRHKNLVTACVWGLLLANAGWNLWELARAGS |
Ga0209056_100919311 | 3300026538 | Soil | LVAVPFLFVFVSGIAADLLESGHKNLVTACVWGLLVANAAWNTWELARAGRG |
Ga0209577_105041502 | 3300026552 | Soil | VAVPFLFVLVSGIAADLLESRHKNLVTACVWGLLAANAGWNLWELARAGLG |
Ga0209626_10271043 | 3300027684 | Forest Soil | FIAGIAADLLETRHRELILASVWGLLTANALWNLAELARVGRL |
Ga0209040_103993061 | 3300027824 | Bog Forest Soil | ATPFLFVFVAGIAADLLETRRRDLVMACVWGLLVANALWNLAELARVGRP |
Ga0209693_106324722 | 3300027855 | Soil | AIASDMLETQRRDLVAACIWGLLLANAFWNLAELARVGKPL |
Ga0209579_103232482 | 3300027869 | Surface Soil | LGFQFMALPFVFVFVAGIAADLVETRYREIALASIWGLLAANAAWSLWELARTG |
Ga0209380_100066671 | 3300027889 | Soil | PFLFVFVAGIAADLLETRQRELVKACVWGLLLANAFWNLAELARLGRPF |
Ga0209415_103033052 | 3300027905 | Peatlands Soil | LLETRQRDPAKACVWGLLVANALWNLAELARVGRPF |
Ga0209526_105662352 | 3300028047 | Forest Soil | AADLLETRYRQIALASVWGLLLASAAWNIWELARAGRG |
Ga0308309_108409811 | 3300028906 | Soil | AADLLETRQHELVRACVWGLLLANVFWNLAELARVGRPF |
Ga0222749_103151611 | 3300029636 | Soil | VPFLFVFVAGIAADLLETRYYQIAVAAIAGLLVANAAWNLWELARIG |
Ga0170822_113175112 | 3300031122 | Forest Soil | FSFQFVAVPFLFVFVAGIAADLVETRHREIALAAIWGLLVANAGWNLWELARIR |
Ga0170820_156302391 | 3300031446 | Forest Soil | FLFVFVAGIAADLLETRYRQLVQAAIWGLLLANAAWHVWELARVGRA |
Ga0302321_1015070831 | 3300031726 | Fen | DLLETKHRNLVLACVWGLLGAYVVWNLAELARAGRG |
Ga0307478_111132191 | 3300031823 | Hardwood Forest Soil | LMAVPFLFVFVAGITADLLETRHRELVKACVWGLLLANAFWNLAELARLGRPF |
Ga0307479_111050821 | 3300031962 | Hardwood Forest Soil | LETPQRDLVKACVWGLLVANALWNLAELARVGRPLLRH |
Ga0311301_101433015 | 3300032160 | Peatlands Soil | LMAVPFLFVFVAGIAADLLETRQRDPAKACVWGLLVANALWNLAELARVGRPF |
Ga0335085_101723601 | 3300032770 | Soil | LLAVPFLFVFVAGVSADLLETQHRSLVMACVWGLLSAQAIWNLWELARIRVG |
Ga0335072_106188661 | 3300032898 | Soil | VAADLLETRQRSAVAACVCGLLLANALWNLMELARVGRS |
Ga0326723_0127993_989_1108 | 3300034090 | Peat Soil | AGIAADLLETRHRQVALAAVWGLLVANGAWNVWELARVA |
⦗Top⦘ |