NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092475

Metagenome / Metatranscriptome Family F092475

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092475
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 39 residues
Representative Sequence MTTATQTGRERETVNSWDKFLERVKSRVSINTFTTWF
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.50 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 85.98 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.953 % of family members)
Environment Ontology (ENVO) Unclassified
(28.972 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.355 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.62%    β-sheet: 0.00%    Coil/Unstructured: 55.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13277YmdB 13.08
PF01436NHL 1.87
PF03551PadR 1.87
PF00149Metallophos 0.93
PF11999Ice_binding 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.87
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.87
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.64 %
UnclassifiedrootN/A23.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001661|JGI12053J15887_10029729All Organisms → cellular organisms → Bacteria → Acidobacteria3068Open in IMG/M
3300002914|JGI25617J43924_10072503All Organisms → cellular organisms → Bacteria → Acidobacteria1258Open in IMG/M
3300002917|JGI25616J43925_10338385Not Available558Open in IMG/M
3300004092|Ga0062389_100146214All Organisms → cellular organisms → Bacteria → Acidobacteria2216Open in IMG/M
3300005454|Ga0066687_10266040All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300005586|Ga0066691_10659434Not Available620Open in IMG/M
3300005993|Ga0080027_10422712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis538Open in IMG/M
3300006052|Ga0075029_100402815All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300006052|Ga0075029_101015209Not Available573Open in IMG/M
3300006175|Ga0070712_101021267All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300006806|Ga0079220_11824375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis536Open in IMG/M
3300006903|Ga0075426_10239079All Organisms → cellular organisms → Bacteria → Acidobacteria1321Open in IMG/M
3300007265|Ga0099794_10072217All Organisms → cellular organisms → Bacteria → Acidobacteria1691Open in IMG/M
3300009088|Ga0099830_10824958All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300009548|Ga0116107_1122825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis743Open in IMG/M
3300010048|Ga0126373_10957602Not Available921Open in IMG/M
3300010326|Ga0134065_10338097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis588Open in IMG/M
3300010335|Ga0134063_10069938All Organisms → cellular organisms → Bacteria → Acidobacteria1560Open in IMG/M
3300010341|Ga0074045_10675496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis656Open in IMG/M
3300010358|Ga0126370_10078869All Organisms → cellular organisms → Bacteria → Acidobacteria2205Open in IMG/M
3300010358|Ga0126370_10160048All Organisms → cellular organisms → Bacteria → Acidobacteria1653Open in IMG/M
3300010358|Ga0126370_10591576All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300010359|Ga0126376_10601402All Organisms → cellular organisms → Bacteria → Acidobacteria1040Open in IMG/M
3300010359|Ga0126376_13023256Not Available520Open in IMG/M
3300010366|Ga0126379_10610584All Organisms → cellular organisms → Bacteria → Acidobacteria1177Open in IMG/M
3300010366|Ga0126379_12527827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis612Open in IMG/M
3300010376|Ga0126381_104337062Not Available549Open in IMG/M
3300010398|Ga0126383_10466663All Organisms → cellular organisms → Bacteria → Acidobacteria1315Open in IMG/M
3300011270|Ga0137391_10038166All Organisms → cellular organisms → Bacteria → Acidobacteria4063Open in IMG/M
3300011270|Ga0137391_10076774All Organisms → cellular organisms → Bacteria → Acidobacteria2875Open in IMG/M
3300012189|Ga0137388_11344624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis654Open in IMG/M
3300012202|Ga0137363_11266793Not Available625Open in IMG/M
3300012203|Ga0137399_11241424All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300012349|Ga0137387_11217065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300012361|Ga0137360_10582131All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300012957|Ga0164303_10564513All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300013100|Ga0157373_10680396All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300014150|Ga0134081_10022161All Organisms → cellular organisms → Bacteria → Acidobacteria1795Open in IMG/M
3300014155|Ga0181524_10048032All Organisms → cellular organisms → Bacteria → Acidobacteria2736Open in IMG/M
3300015054|Ga0137420_1342048All Organisms → cellular organisms → Bacteria → Acidobacteria1714Open in IMG/M
3300015357|Ga0134072_10191741All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300016294|Ga0182041_10760094All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300016371|Ga0182034_11000434All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300016387|Ga0182040_10117472All Organisms → cellular organisms → Bacteria → Acidobacteria1839Open in IMG/M
3300016387|Ga0182040_10226663All Organisms → cellular organisms → Bacteria → Acidobacteria1390Open in IMG/M
3300016445|Ga0182038_10016390All Organisms → cellular organisms → Bacteria → Acidobacteria4342Open in IMG/M
3300017656|Ga0134112_10324822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis623Open in IMG/M
3300017932|Ga0187814_10157620Not Available847Open in IMG/M
3300017947|Ga0187785_10059046All Organisms → cellular organisms → Bacteria → Acidobacteria1455Open in IMG/M
3300017972|Ga0187781_10566957All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300017973|Ga0187780_10071630All Organisms → cellular organisms → Bacteria → Acidobacteria2381Open in IMG/M
3300017999|Ga0187767_10007797All Organisms → cellular organisms → Bacteria → Acidobacteria2005Open in IMG/M
3300018006|Ga0187804_10438649Not Available582Open in IMG/M
3300018088|Ga0187771_10789018All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300018433|Ga0066667_11603158Not Available580Open in IMG/M
3300019278|Ga0187800_1200212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis500Open in IMG/M
3300020199|Ga0179592_10205854All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300020579|Ga0210407_10272993All Organisms → cellular organisms → Bacteria → Acidobacteria1319Open in IMG/M
3300020580|Ga0210403_10139455All Organisms → cellular organisms → Bacteria → Acidobacteria1980Open in IMG/M
3300020580|Ga0210403_11068358Not Available628Open in IMG/M
3300021088|Ga0210404_10499267All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300021168|Ga0210406_10289724All Organisms → cellular organisms → Bacteria → Acidobacteria1334Open in IMG/M
3300021171|Ga0210405_10288290All Organisms → cellular organisms → Bacteria → Acidobacteria1298Open in IMG/M
3300021403|Ga0210397_10521953All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300021420|Ga0210394_10924277Not Available758Open in IMG/M
3300021432|Ga0210384_11593374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis558Open in IMG/M
3300021432|Ga0210384_11829051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis513Open in IMG/M
3300021478|Ga0210402_11386004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis630Open in IMG/M
3300025498|Ga0208819_1053806All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300026281|Ga0209863_10079751All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300026294|Ga0209839_10103030Not Available973Open in IMG/M
3300026317|Ga0209154_1247412All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300026318|Ga0209471_1001116All Organisms → cellular organisms → Bacteria → Acidobacteria16349Open in IMG/M
3300026319|Ga0209647_1051433All Organisms → cellular organisms → Bacteria → Acidobacteria2214Open in IMG/M
3300026330|Ga0209473_1202309All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300026376|Ga0257167_1056213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis609Open in IMG/M
3300026482|Ga0257172_1105028Not Available519Open in IMG/M
3300026496|Ga0257157_1033886All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300026528|Ga0209378_1272360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026557|Ga0179587_10156406All Organisms → cellular organisms → Bacteria → Acidobacteria1423Open in IMG/M
3300026557|Ga0179587_10984424Not Available555Open in IMG/M
3300026942|Ga0207783_1015679All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300027024|Ga0207819_1011923All Organisms → cellular organisms → Bacteria → Acidobacteria1257Open in IMG/M
3300027070|Ga0208365_1055392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis533Open in IMG/M
3300027587|Ga0209220_1005788All Organisms → cellular organisms → Bacteria → Acidobacteria3307Open in IMG/M
3300027605|Ga0209329_1134241Not Available544Open in IMG/M
3300027645|Ga0209117_1014375All Organisms → cellular organisms → Bacteria → Acidobacteria2623Open in IMG/M
3300027706|Ga0209581_1283801Not Available500Open in IMG/M
3300027765|Ga0209073_10458361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis531Open in IMG/M
3300027783|Ga0209448_10169013All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300027787|Ga0209074_10178614All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300027829|Ga0209773_10025608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2328Open in IMG/M
3300027875|Ga0209283_10217503All Organisms → cellular organisms → Bacteria → Acidobacteria1269Open in IMG/M
3300027875|Ga0209283_10487112All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300030991|Ga0073994_11825748Not Available532Open in IMG/M
3300031231|Ga0170824_113525957Not Available711Open in IMG/M
3300031231|Ga0170824_126935844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter1109Open in IMG/M
3300031446|Ga0170820_13290965Not Available504Open in IMG/M
3300031754|Ga0307475_11142249Not Available608Open in IMG/M
3300031910|Ga0306923_11035459All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300031910|Ga0306923_11954259Not Available597Open in IMG/M
3300031942|Ga0310916_11205215Not Available626Open in IMG/M
3300031962|Ga0307479_11002800All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300032180|Ga0307471_104069855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis516Open in IMG/M
3300032205|Ga0307472_102699578Not Available507Open in IMG/M
3300032770|Ga0335085_11765965Not Available635Open in IMG/M
3300033402|Ga0326728_10154522All Organisms → cellular organisms → Bacteria → Acidobacteria2473Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.80%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026942Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J15887_1002972913300001661Forest SoilMTTAPQVGRERETANSWDKFLERVKSRVSINTYTTWFQ
JGI25617J43924_1007250313300002914Grasslands SoilMTTATQAGRERETANSWDKFLDHVKSRVSINTYTTWFQPTRLNR
JGI25616J43925_1033838513300002917Grasslands SoilMTAATNPAREREPINAWDKFLELVKSRVSINTYTTWFQPTR
Ga0062389_10014621433300004092Bog Forest SoilMTTAIQTGRDRDAVNSWDRFLDRVKSRVSINTYTTWFQPTRLN
Ga0066687_1026604033300005454SoilLSLAMTTATQVGREREAGNPWDQFLDHVKARVSINTFTTWF
Ga0066691_1065943423300005586SoilMTTATHIVKERETAGMWDKFLERVKSRVSLNTFTTWF
Ga0080027_1042271213300005993Prmafrost SoilMTTAIQLGRDREPVNSWDTFLEHVKSRVSINTFTTWFQPT
Ga0075029_10040281513300006052WatershedsMTMTTATQIGRERETVNIWDKFLELIKSRVSINTY
Ga0075029_10101520913300006052WatershedsMSILFAMTTATQLGRDHESVNSWDKFLERVKSRVSINTFTTWFQP
Ga0070712_10102126713300006175Corn, Switchgrass And Miscanthus RhizosphereMTTATQTGRETVNSWDKFLDRVKSRVSINTYTTWFQPTR
Ga0079220_1182437513300006806Agricultural SoilMTTATQVGREREAVNSWDKFLDRVKSRVSINTFTTWFQPTR
Ga0075426_1023907923300006903Populus RhizosphereMTTATHIVKDRETTGMWDKFLERVKSRVSLNTFTTWF
Ga0099794_1007221713300007265Vadose Zone SoilVRFFLVMTTATNPARERETANAWDKFLEHVKARVSINTYTTW
Ga0099830_1082495813300009088Vadose Zone SoilMTTAPQVGREREVANSWDKFLEHVKSRVSINTYTTW
Ga0116107_112282533300009548PeatlandMTTATQLGRERETQNVWDKFLELSKSRISINTYTTWFQPTRLNRMEGE
Ga0126373_1095760223300010048Tropical Forest SoilMVGVWHFLMTIAAQLGREKETQNLWEKFLELIKSRVSINTYST
Ga0134065_1033809723300010326Grasslands SoilMTTATHIVKERETTGMWDKFLDRVKSRVSLNTFTTWFAPTRLNHTDGD
Ga0134063_1006993813300010335Grasslands SoilMTTATQVGRERETANAWDKFLEHVKARVSINTFTT
Ga0074045_1067549623300010341Bog Forest SoilMTTATQLGRERETQQNVWDKFLELSKSRISINTYTTWFQPTRLNRMEGE
Ga0126370_1007886913300010358Tropical Forest SoilMTTAAQVGRETTNAWDRFLEHVKARVSINTFTTWFQ
Ga0126370_1016004823300010358Tropical Forest SoilMTTATHIAKDREATGMWDKFLERVKSRVSLNTFTTWFAP
Ga0126370_1059157623300010358Tropical Forest SoilMTTAIQLGREREAANLWDRFLERVKSRISVNTFNTWFQ
Ga0126376_1060140213300010359Tropical Forest SoilMTTATQLGREREAANTWDRFLEHVKARVSINTFTTWFQPT
Ga0126376_1302325613300010359Tropical Forest SoilVLFFVEMTTATNIARERDAANAWDKFLQHVKARVSVNTYGTW
Ga0126379_1061058413300010366Tropical Forest SoilMVKVWHFLMTIATQLGREKETQNLWEKFLELIKSRVSINTYST
Ga0126379_1252782723300010366Tropical Forest SoilMTTATQVGRERETSNAWDKFLEHVKARVSINTFTTWFQ
Ga0126381_10433706223300010376Tropical Forest SoilMAKVWHFLMTIATQIGREKETQNLWEKFLELIKSRVSINTYSTWFQP
Ga0126383_1046666323300010398Tropical Forest SoilMTTAIQTARDREATNCWDKFLEHVKSRVSVNTFST
Ga0137391_1003816643300011270Vadose Zone SoilMTTATQIGRDREVANPWDKFLEHVKSRVSINTFTTWFQPTRLN
Ga0137391_1007677413300011270Vadose Zone SoilMTAATNPAREREPANAWDKFLELVKSRVSINTYTTWFQPT
Ga0137388_1134462413300012189Vadose Zone SoilMTTATQAGRARETANSWDKFLDHVKSRVSINTYTTWFQPTRLNR
Ga0137363_1126679313300012202Vadose Zone SoilMTTATQIGREKEVQNLWDKFLDLIKSRVSINTYSTWF
Ga0137399_1124142413300012203Vadose Zone SoilVEIAEVHSFLVMTAAANPAREREPANAWDKFLELVKSRVS
Ga0137387_1121706513300012349Vadose Zone SoilMTTATQVGREREAGNPWDQFLDHVKARVSINTFTT
Ga0137360_1058213123300012361Vadose Zone SoilMTTAPQLGREREVASPWDKFLEHVKSRVSINTYTTWFQP
Ga0164303_1056451323300012957SoilMTTATQTGRDAANSWDKFLEHVKSRVSINTYTTRFQP
Ga0157373_1068039623300013100Corn RhizosphereMSTATQPGREPFNSWDKFLDRVKQRVSINTFTTWFQP
Ga0134081_1002216133300014150Grasslands SoilMTTAIQVGRERETANSWDKFLEHVKSRVSINTFTTWF
Ga0181524_1004803213300014155BogLVFSITMTTATQLGRERETQNVWDKFLELSKSRISINTYTTW
Ga0137420_134204833300015054Vadose Zone SoilMTTATQIGREREALNSWDKFLDRVKSRVSINTFTTWFQ
Ga0134072_1019174123300015357Grasslands SoilMTTATKTEREREAVNSWDKFLDRVKSRVSINTFTTWFQPTR
Ga0182041_1076009423300016294SoilMTTATQLGRESVTLNVWDKFLDLIKSRVSINTYSTWFQP
Ga0182034_1100043413300016371SoilMMTTTATQLGREPEIVNVWDKFLDLIKSRVSINTFSTWFQ
Ga0182040_1011747233300016387SoilMTTATQIGREREAQNVWDKFLELSKSRVSINTYATWFQPTRLNRL
Ga0182040_1022666313300016387SoilMTTATQLGRESVTLNVWDKFLDLIKSRVSINTYST
Ga0182038_1001639043300016445SoilMTTAIQLGKERAVANLWDKFLERVKSRISINTYTTWFQP
Ga0134112_1032482213300017656Grasslands SoilMTTATQAGRERETANSWDKFLDHVKSRVSINTYTTWFQPTR
Ga0187814_1015762023300017932Freshwater SedimentMTMTTATQVGRERETLNVWDKFLDLIKSRVSINTYS
Ga0187785_1005904613300017947Tropical PeatlandMAHVWHFLMTTATQIGREKETQNLWEKFLDLIKSRVSINTYSTWFQPT
Ga0187781_1056695723300017972Tropical PeatlandMSTATQIGRERETANAWDKFLERVKSRVSINTYTTWFQPT
Ga0187780_1007163013300017973Tropical PeatlandMTTAIQTGRERETLNIWDKFLELIKSRVSINTYSTW
Ga0187767_1000779733300017999Tropical PeatlandMTTATQIGRERETANIWDKFLELIKSRVSINTYTTWFQ
Ga0187804_1043864913300018006Freshwater SedimentMTTATQLGHERETQNVWDKFLELSKSRISINTYTTW
Ga0187771_1078901823300018088Tropical PeatlandMTTAPQLGRALPNPNVWDKFLELIKSRVSINTYST
Ga0066667_1160315813300018433Grasslands SoilMTTATKTEREREAVNSWDKFLDRVKSRVSINTFTT
Ga0187800_120021213300019278PeatlandMTMTTAIQVGRESAALNVWDKFLDLIKSRVSINTFTTWFQPTR
Ga0179592_1020585413300020199Vadose Zone SoilVRLFLVMTAATNPAREREPINAWDKFLELVKSRVS
Ga0210407_1027299323300020579SoilMTTATQTGRDRETVNSWDKFLERVKSRVSINTFTTWFQP
Ga0210403_1013945513300020580SoilMASVWLFLMTTATQIGREKEVQNLWDKFLDLIKSRVSI
Ga0210403_1106835813300020580SoilMITATQVGRERDTQQNVWDKFLDLIKSRVSINTYNT
Ga0210404_1049926723300021088SoilMTAATNPAREREPANAWDKFLELVKSRVSINTYTTW
Ga0210406_1028972423300021168SoilVRLFLVMNAATNTAREREPANAWDKFLELVKSRVSINTYT
Ga0210405_1028829013300021171SoilMTTATQAGREREGANSWDKFLERVKSRVSINTYTTWF
Ga0210397_1052195323300021403SoilMTTAIQTGREREAVNTWEKFLEHVKSRVSINTYTTWFQPT
Ga0210394_1092427723300021420SoilMVQVWLFLMTTATQIGREKEVQNLWDRFLDLIKSRVSINTY
Ga0210384_1159337413300021432SoilMTTATQVGREREAVNSWDKFLDRVKSRVSINTYTTWFQPTRLN
Ga0210384_1182905113300021432SoilMTTATQTGRDRETVNSWDKFLEHVKSRVSINTFTTWF
Ga0210402_1138600413300021478SoilMTTATQTGRDAANSWDKFLEHVKSRVSINTYTTWF
Ga0208819_105380613300025498PeatlandMTTATQLGREHETQQNVWDKFLELSKSRVSINTYTTWFQPTRLNRM
Ga0209863_1007975113300026281Prmafrost SoilMTTAIQLGRDREPVNSWDTFLEHVKSRVSINTFTTWFQPTRLNRA
Ga0209839_1010303023300026294SoilMTTAIHPARELEPVNSWDKFLERVKSRVSINTFTTW
Ga0209154_124741223300026317SoilMTTATKTEREREAVNSWDKFLDRVKSRVSINTFTTWFQ
Ga0209471_100111613300026318SoilMTTVTKTEREREAVNSWDKFLDRVKSRVSINTFTT
Ga0209647_105143313300026319Grasslands SoilMTTATHIVKERETAGMWDKFLERVKSRVSLNTFTT
Ga0209473_120230913300026330SoilMTTATQVGRERETANAWDKFLEHVKARVSINTFTTW
Ga0257167_105621313300026376SoilMTTTINAGRDREGVNSWDKLLERVKSRVSINTFTTWFQPTRLNRAEG
Ga0257172_110502813300026482SoilVEIAEGASFSVMTAATNPAREREPGNAWDKFLELVKSRVSINTY
Ga0257157_103388613300026496SoilMTTATQTGRERETVNSWDKFLERVKSRVSINTFTTWF
Ga0209378_127236013300026528SoilMTTAIQLGRERETANLWDKFLERVKSRVSINTFNTWFQP
Ga0179587_1015640613300026557Vadose Zone SoilMTTATQTGREREAVNSWDKFLERVKSRVSINTFTTWF
Ga0179587_1098442413300026557Vadose Zone SoilVEIAKVRLFLVMTAATNPAREREPINAWDKFLELVKSRVSINTYTT
Ga0207783_101567913300026942Tropical Forest SoilMTMTTATQIGRERETANVWEKFLELIKSRVSINTY
Ga0207819_101192313300027024Tropical Forest SoilMTMTTATQIGRERETANVWDKFLELIKSRVSINTY
Ga0208365_105539213300027070Forest SoilMTTATQVGREREAVNSWDKFLERVKSRVSINTFTTWFQPTRL
Ga0209220_100578813300027587Forest SoilMTTAPQVGRERETANSWDKFLDRVKSRVSINTYTTWFQP
Ga0209329_113424123300027605Forest SoilMTAAANTAREREPVNAWDKFLELVKSRVSINTYTT
Ga0209117_101437513300027645Forest SoilMPKGASFLVITAATNPAREREPANTWDKFLELVKSRVSINTY
Ga0209581_128380123300027706Surface SoilMTTATHIAKEREAAGMWDKFLERVKSRVSLNTFTT
Ga0209073_1045836113300027765Agricultural SoilMTTATQVGREREAVNSWDKFLDRVKSRVSINTFTTWFQPT
Ga0209448_1016901323300027783Bog Forest SoilMTTATQIGREREVLNLWDKFLELIKSRVSINTYSTWF
Ga0209074_1017861413300027787Agricultural SoilMTTATQVGRERETANSWDKFLEHVKARVSINTFTTWFQPT
Ga0209773_1002560813300027829Bog Forest SoilMTTATQISRERDTVNVWDKFLDLIKSRVSINTYST
Ga0209283_1021750323300027875Vadose Zone SoilMTTATQTGREREAVNSWDKFLERVKSRVSINTFTTWFQPT
Ga0209283_1048711223300027875Vadose Zone SoilMTTATQIGREREVANPWDKFLEHVKSRVSINTFTTWFQP
Ga0073994_1182574813300030991SoilMTTAIHPARELEPVNSWDKFLERVKSRVSINTFTTWF
Ga0170824_11352595713300031231Forest SoilMITATQVGRERDTQQNVWDKFLDLIKSRVSINTYNTWFQ
Ga0170824_12693584423300031231Forest SoilMKTAIQLGKEQEVTNLWDKFLERVKSRVSINTFNTWF
Ga0170820_1329096513300031446Forest SoilMTTATQTGRERETVNSWYKFLERVKSRVSINTFTTWFQ
Ga0307475_1114224923300031754Hardwood Forest SoilMTTATQIGREKEVQNLWDKFLDLIKSRVSINTYST
Ga0306923_1103545913300031910SoilMTMTTATQIGRERETANVWDRFLELIKSRVSINTYTTWFQPT
Ga0306923_1195425923300031910SoilMTTAAHIAKEREADGMWDKFLERVKSRVSLNTFTTWFAPTR
Ga0310916_1120521523300031942SoilVTTLMTMTTATQIGREPQTSNVWDRFLELIKSRVSINTYST
Ga0307479_1100280013300031962Hardwood Forest SoilMTTTINAGHDREGVNSWDKLLERVKSRVSINTFTTWFQP
Ga0307471_10406985513300032180Hardwood Forest SoilMTTAIQAGRDREAANLWDKLLERVKSRVSINTFTTWFQPT
Ga0307472_10269957823300032205Hardwood Forest SoilMTTGTQTGRETPNAWEKFLERVKSRVSTNTYTTWFE
Ga0335085_1176596523300032770SoilMSLLFSPQMSTATQTGREPFNSWDKFLDRVKQRVSINTF
Ga0326728_1015452213300033402Peat SoilMTTAAQIGRERETQNVWDKFLELSKSRVSINTYTTWFQPTR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.