NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092472

Metagenome / Metatranscriptome Family F092472

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092472
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 46 residues
Representative Sequence GGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLIGKGG
Number of Associated Samples 98
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 91.59 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.888 % of family members)
Environment Ontology (ENVO) Unclassified
(29.907 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.402 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 19.72%    β-sheet: 0.00%    Coil/Unstructured: 80.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF09723Zn-ribbon_8 68.22
PF00294PfkB 11.21
PF04227Indigoidine_A 5.61
PF07676PD40 4.67
PF13450NAD_binding_8 1.87
PF01593Amino_oxidase 0.93
PF08734GYD 0.93
PF10431ClpB_D2-small 0.93
PF03176MMPL 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG2313Pseudouridine-5'-phosphate glycosidase (pseudoU degradation)Nucleotide transport and metabolism [F] 5.61
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.93
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.93
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_111050786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300001532|A20PFW1_1203476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300002075|JGI24738J21930_10096782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300004081|Ga0063454_100760175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300004114|Ga0062593_100418982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300004114|Ga0062593_100970096All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300004114|Ga0062593_101961809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300004114|Ga0062593_103198363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300004153|Ga0063455_100628183All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300004153|Ga0063455_101248199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300004479|Ga0062595_101229847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300004479|Ga0062595_101422343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300004480|Ga0062592_102508169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300005187|Ga0066675_10307745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1148Open in IMG/M
3300005329|Ga0070683_101658552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300005332|Ga0066388_100121278All Organisms → cellular organisms → Bacteria3137Open in IMG/M
3300005335|Ga0070666_10873764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300005344|Ga0070661_101097400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300005344|Ga0070661_101274922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300005436|Ga0070713_100766507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300005439|Ga0070711_100502544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1000Open in IMG/M
3300005457|Ga0070662_100261736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300005526|Ga0073909_10068122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300005576|Ga0066708_10184267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300005578|Ga0068854_100332333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1238Open in IMG/M
3300005578|Ga0068854_100535961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300005614|Ga0068856_100959518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300005719|Ga0068861_100573887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1031Open in IMG/M
3300005764|Ga0066903_103309211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.871Open in IMG/M
3300005843|Ga0068860_100252820All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300005844|Ga0068862_102093228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300006034|Ga0066656_10786374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300006175|Ga0070712_101168717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300006572|Ga0074051_11785412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300006576|Ga0074047_11947208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300006796|Ga0066665_11388090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300009094|Ga0111539_11885936All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300009101|Ga0105247_11273400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300009174|Ga0105241_11718311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300009176|Ga0105242_10997660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300009840|Ga0126313_10025560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3990Open in IMG/M
3300010041|Ga0126312_10547497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300010044|Ga0126310_10282395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300010322|Ga0134084_10139493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300010333|Ga0134080_10585500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300010335|Ga0134063_10652617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300010360|Ga0126372_10952446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300010373|Ga0134128_11487494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300010403|Ga0134123_10189420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1741Open in IMG/M
3300010999|Ga0138505_100075072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300011999|Ga0120148_1085620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300012198|Ga0137364_11319125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300012285|Ga0137370_10409485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300012285|Ga0137370_10926025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300012355|Ga0137369_10909590All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300012469|Ga0150984_117267614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300012488|Ga0157343_1013013All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300012508|Ga0157315_1027836All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300012515|Ga0157338_1045350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300012907|Ga0157283_10166420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300012911|Ga0157301_10002453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3160Open in IMG/M
3300012915|Ga0157302_10139398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300012948|Ga0126375_11454486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300012975|Ga0134110_10610003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300012976|Ga0134076_10344185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300012989|Ga0164305_10043316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2578Open in IMG/M
3300014326|Ga0157380_11240569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300014969|Ga0157376_11916084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300015372|Ga0132256_101479277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300015372|Ga0132256_103263088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300015374|Ga0132255_106208490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300019885|Ga0193747_1136727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300022756|Ga0222622_10322929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300022915|Ga0247790_10006736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2265Open in IMG/M
3300023057|Ga0247797_1001779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2047Open in IMG/M
3300023062|Ga0247791_1024865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300025917|Ga0207660_10210794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1521Open in IMG/M
3300025922|Ga0207646_11357660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300025926|Ga0207659_10938938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300025930|Ga0207701_10992249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300025931|Ga0207644_10491614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300025935|Ga0207709_11226965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300025981|Ga0207640_11136667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300026067|Ga0207678_10677214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium907Open in IMG/M
3300026116|Ga0207674_10234419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1783Open in IMG/M
3300026536|Ga0209058_1102194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1448Open in IMG/M
3300027036|Ga0207467_1001358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1586Open in IMG/M
3300027453|Ga0207624_100821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1254Open in IMG/M
3300027910|Ga0209583_10677034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300028704|Ga0307321_1032710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium947Open in IMG/M
3300028711|Ga0307293_10129706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300028712|Ga0307285_10081235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300028713|Ga0307303_10151902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300028718|Ga0307307_10189935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300028719|Ga0307301_10012467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2419Open in IMG/M
3300028755|Ga0307316_10010321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2894Open in IMG/M
3300028768|Ga0307280_10407966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300028787|Ga0307323_10112237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300028793|Ga0307299_10125685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300028811|Ga0307292_10017405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2501Open in IMG/M
3300030336|Ga0247826_10291896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300031184|Ga0307499_10060867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300031858|Ga0310892_10922002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300032002|Ga0307416_100679227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300033004|Ga0335084_12451022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300033433|Ga0326726_12258186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300033551|Ga0247830_10815925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027036Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027453Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11105078613300000956SoilENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR*
A20PFW1_120347633300001532PermafrostITPSEDNAKVILMVLGKSALQPPAPSGDTYPPGCRG*
JGI24738J21930_1009678233300002075Corn RhizosphereSTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS*
Ga0063454_10076017513300004081SoilCRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCIS*
Ga0062593_10041898233300004114SoilDITPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG*
Ga0062593_10097009633300004114SoilTGGDITPSEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLGNPTG*
Ga0062593_10196180913300004114SoilPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTLTPGAR*
Ga0062593_10319836323300004114SoilPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCRYGSATG*
Ga0063455_10062818333300004153SoilGTSTGGDITPSQDNANVILMVLGKSAPQPPAPSGDSYPPGCLSR*
Ga0063455_10124819923300004153SoilSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLVGSKG*
Ga0062595_10122984713300004479SoilSEDNAKVILMVLGKSAVQPPSPSGDTFPPGCTYGNAASGR*
Ga0062595_10142234313300004479SoilSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR*
Ga0062592_10250816913300004480SoilDITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR*
Ga0066675_1030774513300005187SoilSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0070683_10165855233300005329Corn RhizosphereGTSAGGDITPSQDNPNAILMVLGKSAPQPPAPSGDSYPPGCLIGNQG*
Ga0066388_10012127863300005332Tropical Forest SoilPSEDNAKVILMVLGRSALQPPAPSGDTYPPGCLLGSPTG*
Ga0070666_1087376433300005335Switchgrass RhizosphereGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG*
Ga0070661_10109740033300005344Corn RhizosphereGTSTGGDITPSQDNPNVILMVLGKSAPQPPAPTGDSYPPGCRVG*
Ga0070661_10127492213300005344Corn RhizosphereTPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG*
Ga0070713_10076650743300005436Corn, Switchgrass And Miscanthus RhizosphereSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLTGK*
Ga0070711_10050254443300005439Corn, Switchgrass And Miscanthus RhizosphereTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS*
Ga0070662_10026173643300005457Corn RhizosphereDRTLHCRLGGTSTGGDITPSQDNANVILMVLGKSAPQRPAPTGDSYPPGCRIG*
Ga0073909_1006812243300005526Surface SoilTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLIGK*
Ga0066708_1018426713300005576SoilSTGGDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGNPVPGSY*
Ga0068854_10033233333300005578Corn RhizosphereGGDITPSQDNPNVILMVLGKSAPQRPAPTGDSYPPGCRVG*
Ga0068854_10053596143300005578Corn RhizosphereTSTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS*
Ga0068856_10095951843300005614Corn RhizosphereTSTGGDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTPSG*
Ga0068861_10057388713300005719Switchgrass RhizosphereWAKFRADRTLHCRLGGTSTGGDITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR*
Ga0066903_10330921113300005764Tropical Forest SoilGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLIGRSG*
Ga0068860_10025282013300005843Switchgrass RhizosphereTGGDITPSQDNANVILMVLGKSAPQRPAPTGDSYPPGCRIG*
Ga0068862_10209322813300005844Switchgrass RhizosphereRTIHCRLGGISTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS*
Ga0066656_1078637413300006034SoilTTIHCRLGGSSTGGSIAPSEDNAKVILMVLGKSAVQPPAPSGDTFPPGCLIGNVPPGR*
Ga0070712_10116871713300006175Corn, Switchgrass And Miscanthus RhizosphereDITPSQDNPNVILMALGKSAPQPPAPTGDSYPPGCRIG*
Ga0074051_1178541223300006572SoilDITPSEDNAKVILMVLGRSAVQPPAQTGDTYPPGCLFGNPAPG*
Ga0074047_1194720813300006576SoilEDNAKVILMVLGRSAVQPPTPTGDTYPPGCLLGNPAPGR*
Ga0066665_1138809023300006796SoilGSDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0111539_1188593613300009094Populus RhizosphereGISTGGDITPSEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLLGSTAS*
Ga0105247_1127340013300009101Switchgrass RhizosphereGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG*
Ga0105241_1171831113300009174Corn RhizosphereRLGGTSTGGDITPSQDNANVILMVLGKSAPQRPAPTGDSYPPGCRVG*
Ga0105242_1099766013300009176Miscanthus RhizosphereDNAKVILMMLGKSAVQPPAPSGDTFPPGCLYGNTVPRG*
Ga0126313_1002556013300009840Serpentine SoilITPSEDNAKVILMVLGKSALQPPAPTGDTYPPGCLTGRNAG*
Ga0126312_1054749743300010041Serpentine SoilHCRLGGTSTGGDITPSEDNAKVILMVLGKSALQPPAPTGDTYPPGCLTGRNAG*
Ga0126310_1028239543300010044Serpentine SoilGDITPSENNANVILMVLGRSAVQPPAPTGDTYPPGCLLGTPQARG*
Ga0134084_1013949313300010322Grasslands SoilAIHCRLGGTSTGSDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0134080_1058550013300010333Grasslands SoilGSIAPSEDNAKVILMVLGKSAVQPPAPSGDTFPPGCLIGNVAPGR*
Ga0134063_1065261713300010335Grasslands SoilISTGGDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVFGNPAPGSY*
Ga0126372_1095244613300010360Tropical Forest SoilTPSEDNAKVILMVLGRSALQPPAPSGDTYPPGCLLGSPTG*
Ga0134128_1148749443300010373Terrestrial SoilILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR*
Ga0134123_1018942043300010403Terrestrial SoilSTGGDITPSQDNPNVILMVLGKSAPQPPAPTGDSYPPGCRVG*
Ga0138505_10007507223300010999SoilTIHCRLGGISTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS*
Ga0120148_108562033300011999PermafrostSTGGDITPSEDNAKVILMVLGKSALQPPAPSGDTYPPGCLG*
Ga0137364_1131912513300012198Vadose Zone SoilEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0137370_1040948533300012285Vadose Zone SoilDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0137370_1092602513300012285Vadose Zone SoilDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVYGNPVPGSY*
Ga0137369_1090959013300012355Vadose Zone SoilSEDNAKVILMVLGRAAVQPPAPSGDTYPPGCFLGSRAPGS*
Ga0150984_11726761423300012469Avena Fatua RhizosphereVGWNKFRAGSTIHCRLGGISTGSDIERSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGNPPPR*
Ga0157343_101301333300012488Arabidopsis RhizosphereDITPSEDNAKVILMVLGRSALQPPAPSGDTYPPGCLLGNPAG*
Ga0157315_102783613300012508Arabidopsis RhizosphereTPSEDNAKVILMVLGRSALQPPAPSGDTYPPGCLLGNPAG*
Ga0157338_104535033300012515Arabidopsis RhizosphereLGGISTGGDITPSEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLLGNPAG*
Ga0157283_1016642013300012907SoilCRLGGTSTGGDITPSQDNPNVILMVLGKSAPQRPAPTGDSYPPGCRVG*
Ga0157301_1000245313300012911SoilNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR*
Ga0157302_1013939843300012915SoilGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLIGKGG*
Ga0126375_1145448613300012948Tropical Forest SoilSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLYGNTVPAG*
Ga0134110_1061000313300012975Grasslands SoilILMVLGKSAVQPPAPSGDTYPPGCVYGTRAPGAR*
Ga0134076_1034418533300012976Grasslands SoilRAGSTIHCRLGGTSTGSDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR*
Ga0164305_1004331663300012989SoilEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLTSK*
Ga0157380_1124056913300014326Switchgrass RhizosphereTPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLIGSGG*
Ga0157376_1191608413300014969Miscanthus RhizosphereKFRADRTLHCRLGGTSTGGDITPSQDNANVILMVLGKSAPQRPAPTGDSYPPGCRIG*
Ga0132256_10147927743300015372Arabidopsis RhizosphereTPSEDNANVILMVLGKSAVQPPKPSGDTYPPGCLLGTPAARG*
Ga0132256_10326308813300015372Arabidopsis RhizosphereNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG*
Ga0132255_10620849023300015374Arabidopsis RhizosphereSTGGGITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGTQRAGG*
Ga0193747_113672733300019885SoilITPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLTGK
Ga0222622_1032292913300022756Groundwater SedimentIHCRLGGISTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS
Ga0247790_1000673613300022915SoilNVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR
Ga0247797_100177913300023057SoilLGGTSTGGDITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR
Ga0247791_102486533300023062SoilGGDITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR
Ga0207660_1021079443300025917Corn RhizosphereRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLIGSGG
Ga0207646_1135766013300025922Corn, Switchgrass And Miscanthus RhizosphereLGGTSTGGDITPSQDNANVILMVLGQSAPQRPAPTGDSYPPGCRVG
Ga0207659_1093893813300025926Miscanthus RhizosphereSDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR
Ga0207701_1099224913300025930Corn, Switchgrass And Miscanthus RhizosphereDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR
Ga0207644_1049161413300025931Switchgrass RhizosphereRAGRTLHGRLGGTSTGGDITPSQDNPNVILMVLGKSAPQPPAPSGDSYPPGCLIGSGG
Ga0207709_1122696533300025935Miscanthus RhizosphereRTLHCRLGGTSTGGDITPSEDNAKVILMVLGMSAPQPPAPSGDTYPPGCLTR
Ga0207640_1113666713300025981Corn RhizosphereAKFRADRTLHCRLGGTSTGGDITPSQDNANVILMVLGKSAPQRPAPTGDSYPPGCRVG
Ga0207678_1067721413300026067Corn RhizosphereDNAKVILMVLGKSAPQQPAPSGDSYPPGCLIGSGG
Ga0207674_1023441913300026116Corn RhizosphereHCRLGGTSTGGDITPSQDNPNVILMVLGKSAPQPPAPSGDSYPPGCLIGSGG
Ga0209058_110219413300026536SoilTGGDITPSEDNAKVILMVLGKSAIQPPPPNGDTYPPGCFVGNHPPGTR
Ga0207467_100135823300027036SoilVERAVVDGGTSTGGDITPSENNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR
Ga0207624_10082113300027453SoilNNANVILMVLGKSAVQPPAPTGDTYPPGCLIGAPQAGR
Ga0209583_1067703423300027910WatershedsITPSEDNAKVILMVLGRSAVQPPAPTGDTYPPGCLLGNPAPGR
Ga0307321_103271033300028704SoilEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLLGSPAQGG
Ga0307293_1012970633300028711SoilHCRLGGSSTGGSITPSEDNAKVILMILGKSAVQPPAPSGDTFPPGCLVGNVAPR
Ga0307285_1008123513300028712SoilSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR
Ga0307303_1015190213300028713SoilRLGGTSTGGDITPSEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLLGGPAQGG
Ga0307307_1018993533300028718SoilISTGGDITPSEDNAKVILMVLGKSAVQPPAPTGDTYPPGCLLGSPTGS
Ga0307301_1001246713300028719SoilSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLVGNRPPA
Ga0307316_1001032173300028755SoilGSTIHCRLGGTSTGSDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR
Ga0307280_1040796623300028768SoilHCRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLIGNRPPS
Ga0307323_1011223713300028787SoilSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLVGNRPPA
Ga0307299_1012568543300028793SoilTPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCIYGTRTPGAR
Ga0307292_1001740553300028811SoilRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDSYPPGCLTGK
Ga0247826_1029189643300030336SoilHCRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPSGDTYPPGCLSG
Ga0307499_1006086713300031184SoilRADRTLHCRLGGTSTGGDITPSQDNPNVILMVLGKSAPQPPAPTGDSYPPGCRVG
Ga0310892_1092200233300031858SoilLHCRLGGTSTGGDITPSEDNAKVILMVLGKSAPQPPAPTGDTYPPGCLIGRTG
Ga0307416_10067922733300032002RhizosphereTSTGGDITPSEDNAKVISMVLGRSAPQPPAPSGDTYPPGCFIGARPPGTG
Ga0335084_1245102223300033004SoilRLGGISTGGDITPSEDNAKVILMVLGKSAVQPPAPSGDTYPPGCVFGNPAPGSY
Ga0326726_1225818613300033433Peat SoilGGDITPSEDNAKVILMVLGRSAVQPPAPSGDTYPPGCLLGNPAPS
Ga0247830_1081592513300033551SoilIHCRLGGTSTGGDITPSEDNANVILMVLGKSAVQPPRPSGDTYPPGCLIGTPRAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.