Metagenome / Metatranscriptome Family F092426

Basic Information
Family ID	F092426
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	39 residues
Representative Sequence	QNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR
Number of Associated Samples	97
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.07 %
% of genes from short scaffolds (< 2000 bps)	90.65 %
Associated GOLD sequencing projects	92
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Bacteria (85.981 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (6.542 % of family members)
Environment Ontology (ENVO)	Unclassified (36.449 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.664 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF00753	Lactamase_B	9.35
PF01436	NHL	2.80
PF13548	DUF4126	2.80
PF13360	PQQ_2	1.87
PF03450	CO_deh_flav_C	1.87
PF03401	TctC	0.93
PF00989	PAS	0.93
PF04199	Cyclase	0.93
PF08281	Sigma70_r4_2	0.93
PF12680	SnoaL_2	0.93
PF11412	DsbC	0.93
PF00440	TetR_N	0.93
PF13472	Lipase_GDSL_2	0.93
PF01738	DLH	0.93
PF01416	PseudoU_synth_1	0.93
PF12616	DUF3775	0.93
PF01609	DDE_Tnp_1	0.93
PF01435	Peptidase_M48	0.93
PF02371	Transposase_20	0.93
PF08327	AHSA1	0.93
PF13415	Kelch_3	0.93
PF04203	Sortase	0.93
PF11455	MazE-like	0.93
PF13460	NAD_binding_10	0.93
PF14312	FG-GAP_2	0.93
PF04909	Amidohydro_2	0.93
PF02321	OEP	0.93
PF02738	MoCoBD_1	0.93
PF02678	Pirin	0.93
PF13531	SBP_bac_11	0.93
PF00254	FKBP_C	0.93
PF13442	Cytochrome_CBB3	0.93
PF00724	Oxidored_FMN	0.93
PF13343	SBP_bac_6	0.93
PF10518	TAT_signal	0.93
PF09587	PGA_cap	0.93
PF00300	His_Phos_1	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.87
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.93
COG0101	tRNA U38,U39,U40 pseudouridine synthase TruA	Translation, ribosomal structure and biogenesis [J]	0.93
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.93
COG1878	Kynurenine formamidase	Amino acid transport and metabolism [E]	0.93
COG1902	2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family	Energy production and conversion [C]	0.93
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.93
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.93
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.93
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.93
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.93
COG3764	Sortase (surface protein transpeptidase)	Cell wall/membrane/envelope biogenesis [M]	0.93
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.93
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.93
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.92 %
Unclassified	root	N/A	13.08 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.92 %
Unclassified	root	N/A	13.08 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	85.98 %
Unclassified	root	N/A	13.08 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	34.58 %
Unclassified	root	N/A	13.08 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	11.21 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.80 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.93 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	13.08 %
Unclassified	root	N/A	13.08 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7.48 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.80 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.87 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.87 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.93 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.93 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.93 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.93 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.93 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.93 %
Acidimicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales	0.93 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.93 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.93 %
Ilumatobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae	0.93 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.93 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.93 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.93 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.93 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
Ilumatobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter	0.93 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.93 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.93 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.93 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.93 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.93 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
unclassified Ilumatobacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter	0.93 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.93 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.93 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.93 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.93 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.15 %
Ilumatobacter sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp.	0.93 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.93 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.93 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.93 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.93 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	0.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000567\|JGI12270J11330_10085849	All Organisms → cellular organisms → Bacteria → Proteobacteria	1455	Open in IMG/M
3300005177\|Ga0066690_10267687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1149	Open in IMG/M
3300005331\|Ga0070670_101732455	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300005459\|Ga0068867_100840619	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300005538\|Ga0070731_10214017	All Organisms → cellular organisms → Bacteria → Proteobacteria	1279	Open in IMG/M
3300005541\|Ga0070733_10406832	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300005548\|Ga0070665_100770905	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300005555\|Ga0066692_10783828	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	587	Open in IMG/M
3300005559\|Ga0066700_11122068	All Organisms → cellular organisms → Bacteria → Acidobacteria	514	Open in IMG/M
3300005563\|Ga0068855_100346647	All Organisms → cellular organisms → Bacteria	1637	Open in IMG/M
3300005719\|Ga0068861_100113595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2173	Open in IMG/M
3300005836\|Ga0074470_11081368	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300005844\|Ga0068862_101328165	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300006176\|Ga0070765_100353022	All Organisms → cellular organisms → Bacteria	1367	Open in IMG/M
3300006237\|Ga0097621_100008089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7554	Open in IMG/M
3300006800\|Ga0066660_10044830	All Organisms → cellular organisms → Bacteria	2842	Open in IMG/M
3300006854\|Ga0075425_102182665	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300006903\|Ga0075426_11290416	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300007004\|Ga0079218_13648011	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300009012\|Ga0066710_101274949	Not Available	1139	Open in IMG/M
3300009089\|Ga0099828_11710617	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300009090\|Ga0099827_11609218	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	566	Open in IMG/M
3300009093\|Ga0105240_10006166	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	17670	Open in IMG/M
3300009094\|Ga0111539_11876834	All Organisms → cellular organisms → Bacteria → Acidobacteria	695	Open in IMG/M
3300009098\|Ga0105245_10855823	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300009148\|Ga0105243_12395261	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	566	Open in IMG/M
3300009177\|Ga0105248_10073190	All Organisms → cellular organisms → Bacteria	3851	Open in IMG/M
3300009545\|Ga0105237_10257110	All Organisms → cellular organisms → Bacteria	1749	Open in IMG/M
3300009678\|Ga0105252_10109579	Not Available	1116	Open in IMG/M
3300009777\|Ga0105164_10678928	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	506	Open in IMG/M
3300010043\|Ga0126380_11792536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	555	Open in IMG/M
3300010047\|Ga0126382_11208060	All Organisms → cellular organisms → Bacteria → Acidobacteria	678	Open in IMG/M
3300010154\|Ga0127503_10974017	All Organisms → cellular organisms → Bacteria → Acidobacteria	773	Open in IMG/M
3300010333\|Ga0134080_10574026	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	545	Open in IMG/M
3300010343\|Ga0074044_10970465	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300010362\|Ga0126377_10133343	All Organisms → cellular organisms → Bacteria	2312	Open in IMG/M
3300010366\|Ga0126379_13888028	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	500	Open in IMG/M
3300010379\|Ga0136449_103665931	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581	Open in IMG/M
3300010398\|Ga0126383_12908797	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300010400\|Ga0134122_13355911	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300010401\|Ga0134121_11218161	All Organisms → cellular organisms → Bacteria → Acidobacteria	753	Open in IMG/M
3300010401\|Ga0134121_11975106	All Organisms → cellular organisms → Bacteria → Acidobacteria	615	Open in IMG/M
3300011119\|Ga0105246_11811248	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300011120\|Ga0150983_12901232	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	532	Open in IMG/M
3300012200\|Ga0137382_10881690	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300012201\|Ga0137365_10216980	All Organisms → cellular organisms → Bacteria	1428	Open in IMG/M
3300012923\|Ga0137359_11015873	Not Available	711	Open in IMG/M
3300012925\|Ga0137419_10762912	All Organisms → cellular organisms → Bacteria → Acidobacteria	789	Open in IMG/M
3300012925\|Ga0137419_11872301	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21	514	Open in IMG/M
3300012972\|Ga0134077_10360640	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	621	Open in IMG/M
3300013297\|Ga0157378_10015235	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6733	Open in IMG/M
3300013297\|Ga0157378_11314963	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	764	Open in IMG/M
3300014167\|Ga0181528_10898114	Not Available	501	Open in IMG/M
3300014745\|Ga0157377_11400944	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300014969\|Ga0157376_10854570	All Organisms → cellular organisms → Bacteria → Acidobacteria	925	Open in IMG/M
3300014969\|Ga0157376_11737234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	659	Open in IMG/M
3300015371\|Ga0132258_12617293	All Organisms → cellular organisms → Bacteria → Acidobacteria	1260	Open in IMG/M
3300015373\|Ga0132257_103083819	All Organisms → cellular organisms → Bacteria → Acidobacteria	607	Open in IMG/M
3300015374\|Ga0132255_101387070	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1061	Open in IMG/M
3300015374\|Ga0132255_103637141	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300015374\|Ga0132255_104269956	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606	Open in IMG/M
3300016387\|Ga0182040_10140927	Not Available	1704	Open in IMG/M
3300016387\|Ga0182040_10517721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	955	Open in IMG/M
3300018000\|Ga0184604_10121073	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300018037\|Ga0187883_10660045	All Organisms → cellular organisms → Bacteria → Acidobacteria	545	Open in IMG/M
3300018433\|Ga0066667_10553176	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	955	Open in IMG/M
3300018466\|Ga0190268_12350008	Not Available	504	Open in IMG/M
3300018481\|Ga0190271_13884859	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300020580\|Ga0210403_11393825	Not Available	531	Open in IMG/M
3300022718\|Ga0242675_1106369	Not Available	546	Open in IMG/M
3300025907\|Ga0207645_10903165	All Organisms → cellular organisms → Bacteria → Acidobacteria	600	Open in IMG/M
3300025912\|Ga0207707_10200648	All Organisms → cellular organisms → Bacteria	1739	Open in IMG/M
3300025912\|Ga0207707_10823646	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300025924\|Ga0207694_11113756	All Organisms → cellular organisms → Bacteria → Acidobacteria	668	Open in IMG/M
3300025927\|Ga0207687_11183021	Not Available	657	Open in IMG/M
3300025939\|Ga0207665_10261454	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300025949\|Ga0207667_10570776	All Organisms → cellular organisms → Bacteria	1143	Open in IMG/M
3300026023\|Ga0207677_11050752	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300026067\|Ga0207678_10019942	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	5892	Open in IMG/M
3300026089\|Ga0207648_10581557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1031	Open in IMG/M
3300026116\|Ga0207674_11272031	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300026121\|Ga0207683_11967859	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300026142\|Ga0207698_12231498	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300026532\|Ga0209160_1103331	All Organisms → cellular organisms → Bacteria → Acidobacteria	1438	Open in IMG/M
3300027682\|Ga0209971_1127114	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	627	Open in IMG/M
3300027842\|Ga0209580_10399360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	685	Open in IMG/M
3300027876\|Ga0209974_10086416	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300027911\|Ga0209698_11270018	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300028800\|Ga0265338_11028674	All Organisms → cellular organisms → Bacteria → Acidobacteria	557	Open in IMG/M
3300028906\|Ga0308309_11363466	All Organisms → cellular organisms → Bacteria → Acidobacteria	609	Open in IMG/M
3300029943\|Ga0311340_11130837	Not Available	635	Open in IMG/M
3300031421\|Ga0308194_10103906	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	821	Open in IMG/M
3300031525\|Ga0302326_10161317	All Organisms → cellular organisms → Bacteria	3833	Open in IMG/M
3300031525\|Ga0302326_12142716	Not Available	716	Open in IMG/M
3300031708\|Ga0310686_104297094	All Organisms → cellular organisms → Bacteria → Acidobacteria	520	Open in IMG/M
3300031720\|Ga0307469_12230776	Not Available	533	Open in IMG/M
3300031724\|Ga0318500_10710908	All Organisms → cellular organisms → Bacteria → Acidobacteria	512	Open in IMG/M
3300031788\|Ga0302319_10251798	Not Available	2139	Open in IMG/M
3300031820\|Ga0307473_11133742	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300031912\|Ga0306921_11931777	All Organisms → cellular organisms → Bacteria → Proteobacteria	631	Open in IMG/M
3300031945\|Ga0310913_10529205	All Organisms → cellular organisms → Bacteria → Acidobacteria	837	Open in IMG/M
3300031962\|Ga0307479_11048283	All Organisms → cellular organisms → Bacteria → Acidobacteria	783	Open in IMG/M
3300031962\|Ga0307479_11072114	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300032059\|Ga0318533_10396314	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300032060\|Ga0318505_10569028	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	533	Open in IMG/M
3300032829\|Ga0335070_11080676	Not Available	739	Open in IMG/M
3300032954\|Ga0335083_10449227	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp.	1090	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.55%
Host-Associated	Host-Associated	36.45%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	56.07%
Plants	Host-Associated → Plants	36.45%
Aquatic	Environmental → Aquatic	7.48%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.34%
Rhizosphere	Host-Associated → Plants → Rhizosphere	19.63%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.89%
Freshwater	Environmental → Aquatic → Freshwater	3.74%
Sediment	Environmental → Aquatic → Sediment	3.74%
Peat	Environmental → Terrestrial → Peat	3.74%
Roots	Host-Associated → Plants → Roots	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.95%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.28%
Loam	Environmental → Terrestrial → Soil → Loam	5.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.74%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.74%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.80%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.87%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.93%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.93%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.93%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.95%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.15%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.28%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.74%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.74%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.80%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.80%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.87%
Unchlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.93%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.74%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.74%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.80%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.80%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.80%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.80%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.87%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.87%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.87%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.87%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.87%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.87%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.93%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.93%
Wastewater	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater	0.93%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.93%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.93%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009777	Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014167	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018037	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300022718	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029943	I_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031525	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031788	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F092426

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12270J11330_100858491	3300000567	Peatlands Soil	ARQLICIQNGSSDGTTVEPMKKVVANLSEDDIIAISAYLGSLPPK*
Ga0066690_102676871	3300005177	Soil	ICMQNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR*
Ga0070670_1017324551	3300005331	Switchgrass Rhizosphere	VYLARQLIMMRNGSSAGQAAQLMQQVVARLSEDDIISISAYLGSLPPQ*
Ga0068867_1008406191	3300005459	Miscanthus Rhizosphere	QLITMQNGTSAGANAALMKKPVAKLSEDDIIAISAYLGSLPPR*
Ga0070731_102140171	3300005538	Surface Soil	ICIQNGSSAGAAVAPMKKVVANLSEDDIIAISAYLGSLPPQ*
Ga0070733_104068323	3300005541	Surface Soil	RQLICIQNGSSAGAAVAPMKKVVTNLSEDDIIAISAYLGSLSPR*
Ga0070665_1007709052	3300005548	Switchgrass Rhizosphere	SAGANAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0066692_107838282	3300005555	Soil	LFDLQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE*
Ga0066700_111220681	3300005559	Soil	ARQLIGIQNGSSNGTAVALMKKPVAKLSEDDIISIAAYLGSLPPTTNH*
Ga0068855_1003466471	3300005563	Corn Rhizosphere	TSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0068861_1001135954	3300005719	Switchgrass Rhizosphere	YIARQLITMQNGTSAGANAVLMKKPVAKLSEDDIIAISAYLGSLPPR*
Ga0074470_110813681	3300005836	Sediment (Intertidal)	GSSAGTAAGLMKKVVEKLSEDDIIAISAYVGSLPPQ*
Ga0068862_1013281652	3300005844	Switchgrass Rhizosphere	TARQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR*
Ga0070765_1003530221	3300006176	Soil	SAGTAVALMKKVVSNLSEDDIISISAYLGSLPPQ*
Ga0097621_1000080891	3300006237	Miscanthus Rhizosphere	SMENGSSAGTNSAPMKPVVAKLSEDDVIAISAYLGSLPPR*
Ga0066660_100448301	3300006800	Soil	IARQLISMQNGSSAGTAVALMKKTVSNLSEDDTISISAYLGSLPP*
Ga0075425_1021826651	3300006854	Populus Rhizosphere	YGSSAGKAAALMKAVVTNLSDEDIIAISAYVGSLPPQ*
Ga0075426_112904161	3300006903	Populus Rhizosphere	SAGANAALMKKPLAKLTEDDIIAISAYLGSLSPR*
Ga0079218_136480111	3300007004	Agricultural Soil	NGTSAGANAALMKKVVANLSEDEIIALSAYLGSLSPR*
Ga0066710_1012749491	3300009012	Grasslands Soil	HGRSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ
Ga0099828_117106172	3300009089	Vadose Zone Soil	ITIQNGASAGTAVALMKKAVANLSEDDIISISAYLGSLAP*
Ga0099827_116092181	3300009090	Vadose Zone Soil	MRYGSSAGKAAALMKAVVTNLAEDDIIAISAYVASLPPQ*
Ga0105240_100061661	3300009093	Corn Rhizosphere	SAGTNAALMKKAVANLSEDDIIAISAYLGSLTPQ*
Ga0111539_118768341	3300009094	Populus Rhizosphere	SAGKAAALMKKVVSNLSEDDIISISAYLGSLPPR*
Ga0105245_108558232	3300009098	Miscanthus Rhizosphere	QNGSSAGTNAALMKKAVANLTEDDIISISAYLRTLSPQ*
Ga0105243_123952611	3300009148	Miscanthus Rhizosphere	IQNGSSAGTAVALMKKAVANLSEDDIISISAYLGSLSPH*
Ga0105248_100731901	3300009177	Switchgrass Rhizosphere	LITMQNGTSAGANAALMKKVVAKLSEDDIIALSAYVGSLPPK*
Ga0105237_102571101	3300009545	Corn Rhizosphere	QLIQMQNGSSAGANAALMKKAVANLTEDDIISISAYLGTLTPQ*
Ga0105252_101095791	3300009678	Soil	TSAGANAALMKKAVEKLSEDEIIALSAYLGSLPPR*
Ga0105164_106789282	3300009777	Wastewater	IQNGSSAGTASALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0126380_117925362	3300010043	Tropical Forest Soil	SSAGKAAELMKPVVANLSEDDIIAISSYLGSLPPQ*
Ga0126382_112080601	3300010047	Tropical Forest Soil	SAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR*
Ga0127503_109740171	3300010154	Soil	ARQLFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLTP*
Ga0134080_105740261	3300010333	Grasslands Soil	LMTMQNGTSAGANAALMKKPVSKLSEDDIISISAYLGSLPSQ*
Ga0074044_109704651	3300010343	Bog Forest Soil	MDIQNGTSAGKAVALMKNVVAKLSEDEIIAISAYVGTLPPQ*
Ga0126377_101333431	3300010362	Tropical Forest Soil	RSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ*
Ga0126379_138880281	3300010366	Tropical Forest Soil	SAGASSAPMQPTVAKLSEDDVIAISAYLGSLPPR*
Ga0136449_1036659311	3300010379	Peatlands Soil	QLICMQNGSSAGTAAALMKKVVANLSEDDIIAISAYLGSLPPQ*
Ga0126383_129087971	3300010398	Tropical Forest Soil	FQNNSRVGASSLLMKPVVAKLTEDDMIAISAYLGSLAE*
Ga0134122_133559111	3300010400	Terrestrial Soil	ITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR*
Ga0134121_112181612	3300010401	Terrestrial Soil	WLFDMRYGSSAGKAAALMKAVVTNLSEDDIIAISSYVASLPPQ*
Ga0134121_119751061	3300010401	Terrestrial Soil	DIQYGSSNGKAVALMKGPVAKLKEDDIIAISAYLGSLRPE*
Ga0105246_118112481	3300011119	Miscanthus Rhizosphere	QNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0150983_129012322	3300011120	Forest Soil	QLFDIQYGSSAGKAVELMKGPVAHLTEDDIIAISAYLGSLVLE*
Ga0137382_108816901	3300012200	Vadose Zone Soil	LICIQIGSSAGTAAALMKKVVSNLSEDDIIAISAYLGSLPPQ*
Ga0137365_102169802	3300012201	Vadose Zone Soil	QNGTSAGANAALMKKVVVNLSEDDIIALSAYLGSLPPR*
Ga0137359_110158732	3300012923	Vadose Zone Soil	SRGGKEVEPMKPVVANLSEDDIIAISSYLGSLPPA*
Ga0137419_107629121	3300012925	Vadose Zone Soil	RQLICIQNGSSAGIAVALMKKAVSNLSEDDIISISAYLGSLPPQ*
Ga0137419_118723011	3300012925	Vadose Zone Soil	SAGKAAALMKRAVASISEDDIIAISAYLGSLSPE*
Ga0134077_103606401	3300012972	Grasslands Soil	GSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE*
Ga0157378_100152359	3300013297	Miscanthus Rhizosphere	ICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0157378_113149633	3300013297	Miscanthus Rhizosphere	QLFDLQYGSSAGKAAALMKRAVEHLSEDDIIAISAYLGSLAPR*
Ga0181528_108981141	3300014167	Bog	QLICIQNGASAGVAVELMKKVVSNLSEDDIIAISAYLGTLPPK*
Ga0157377_114009442	3300014745	Miscanthus Rhizosphere	QNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR*
Ga0157376_108545701	3300014969	Miscanthus Rhizosphere	QMQNGTSAGANAALMKKVVAKLTEDDIIAISAYLGSLPPR*
Ga0157376_117372341	3300014969	Miscanthus Rhizosphere	LITMQNGTSAGANAALMKKVVAKLSEDDVIALSAYLGSLPPK*
Ga0132258_126172931	3300015371	Arabidopsis Rhizosphere	SAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0132257_1030838192	3300015373	Arabidopsis Rhizosphere	SAGANAALMNRVVAKLTEDDIISLAAYVGSLPPK*
Ga0132255_1013870701	3300015374	Arabidopsis Rhizosphere	MQNGASAGTNAALMKKVVAKLSEEDIIAISAYLGSLPPR*
Ga0132255_1036371412	3300015374	Arabidopsis Rhizosphere	LICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0132255_1042699562	3300015374	Arabidopsis Rhizosphere	SAGKAAALMKAVVVNLTDDDIIAISAYVASLPPQ*
Ga0182040_101409272	3300016387	Soil	GSSAGKAAEAMKPVVANLTEDDIIAISSYLGSLPPQ
Ga0182040_105177211	3300016387	Soil	SSAGKAAALMKPVVANLSEDDIIAIASYLGSLPPQ
Ga0184604_101210731	3300018000	Groundwater Sediment	RQLITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR
Ga0187883_106600451	3300018037	Peatland	GSSAGVAVELMKKVVSDLSEDDIIAISAYLGSLPPR
Ga0066667_105531761	3300018433	Grasslands Soil	TSAAAKATLMKKPVSKLSEDDIIWISAYLGSLPPE
Ga0190268_123500081	3300018466	Soil	RQLITIQNGTNAGTAVALMKKVVAHLSEEDIISISAYLGSLPPQ
Ga0190271_138848591	3300018481	Soil	NGSSAGTNSAPMKPAVANLSEDDVIAISAYLGSLPPR
Ga0210403_113938251	3300020580	Soil	NGSRNGADDASMKKVVEKLSVDDIIAISAYLGSLPPQ
Ga0242675_11063692	3300022718	Soil	SSAGKAAELIKPVVANLSEDDIIAISSYLGSLPPQ
Ga0207645_109031652	3300025907	Miscanthus Rhizosphere	RQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR
Ga0207707_102006482	3300025912	Corn Rhizosphere	QLITMQNGTSAGANAALMKRVVAKLSEDDIISLSAYLGSLPPK
Ga0207707_108236462	3300025912	Corn Rhizosphere	QLICLQNGTSAGANAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207694_111137561	3300025924	Corn Rhizosphere	LFDLQYGSSAGKAAALMKKTVTGLSEDDIINISAYLGSLPPQ
Ga0207687_111830211	3300025927	Miscanthus Rhizosphere	FGSSAGKAAALMKAVVRNLSDDDIIALAAYVGSLPPQ
Ga0207665_102614543	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	QLICLQNGSSAGTNAALMKKAVANLSEDDIIAISAYLGTLPPQ
Ga0207667_105707761	3300025949	Corn Rhizosphere	GTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207677_110507522	3300026023	Miscanthus Rhizosphere	LICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207678_100199426	3300026067	Corn Rhizosphere	YTARQLFYMQHGSSAGKAVALMKGVVGKLSERDIIDISAYLGSLPPR
Ga0207648_105815571	3300026089	Miscanthus Rhizosphere	ARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR
Ga0207674_112720311	3300026116	Corn Rhizosphere	TSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207683_119678591	3300026121	Miscanthus Rhizosphere	SSAGKAAALMKAVVTNLSEDDIIAISAYVASLPPH
Ga0207698_122314982	3300026142	Corn Rhizosphere	LICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ
Ga0209160_11033312	3300026532	Soil	QNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR
Ga0209971_11271141	3300027682	Arabidopsis Thaliana Rhizosphere	YGSSAGKAAELMKAAVKNLSDDDIIAISSYLGSLPPQ
Ga0209580_103993601	3300027842	Surface Soil	DMQYGSSSGKAAEPMKPVVANLKEDDIIAISAYLGSLPPQ
Ga0209974_100864162	3300027876	Arabidopsis Thaliana Rhizosphere	LARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR
Ga0209698_112700182	3300027911	Watersheds	LSAGSASAPMKKVVANLSEDDIIAISAYLGSLPPQ
Ga0265338_110286741	3300028800	Rhizosphere	GSSAGTAVALMKKPVAHLSEDDIIAISAYLGSLPPK
Ga0308309_113634662	3300028906	Soil	SSAGKAAALMKAVVANLSEDDIIAISASVASLPPQ
Ga0311340_111308372	3300029943	Palsa	LICMQNGSSAGKAAALMKKAVANLSEDDIIAISAYLGSLPPQ
Ga0308194_101039061	3300031421	Soil	LFDLRYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE
Ga0302326_101613175	3300031525	Palsa	QYGSSAGRAAALMKRAVANLSEDDIIAISAYLGSLPPQ
Ga0302326_121427162	3300031525	Palsa	NGSSAGTAVALMKKAVAGLSEDDIIAISAYVGSLPPR
Ga0310686_1042970941	3300031708	Soil	ARQLILMQNGSSAGTAAALMKKVVANLSEDDIIAISSYLGSLPPQ
Ga0307469_122307761	3300031720	Hardwood Forest Soil	ASGGANAALMKKPVAKLTEEDIIAIAAYLGSLPPH
Ga0318500_107109081	3300031724	Soil	LFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLAPE
Ga0302319_102517983	3300031788	Bog	DKQGLSGSASLLMQPVVAKLTMDDMIAISAYVASLPP
Ga0307473_111337422	3300031820	Hardwood Forest Soil	SMQNGSSAGTNSALMKPAVANLSENDVIAIAAYLGSLPPR
Ga0306921_119317772	3300031912	Soil	LFDMQYGSSAGAAAAAMKPVVANLNEDDIIAISSYLGSLPPK
Ga0310913_105292051	3300031945	Soil	LQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPR
Ga0307479_110482832	3300031962	Hardwood Forest Soil	SSAGTAAALMKKVVANLSEDDIISISAYLGSLPPR
Ga0307479_110721141	3300031962	Hardwood Forest Soil	GSSAGVNTALMKKAVANLTEDDIISISAYLGALAPQ
Ga0318533_103963142	3300032059	Soil	TMQNGTSAGVNAALMKKVVANLSEDDVIALSAYLGSLPPR
Ga0318505_105690281	3300032060	Soil	SRTGDAATPMKPVVANLSDEDIIAISSYLGSLSPS
Ga0335070_110806762	3300032829	Soil	GMQKGSSAGSSSAPMKPVVAKLSEDDVIAISAYLGSLPPR
Ga0335083_104492273	3300032954	Soil	ICIQNGSSAGTAVALMKKVVARLSEDDVIAISAYLGSLPPR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign