


| Basic Information | |
|---|---|
| Family ID | F092389 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.77 % |
| % of genes near scaffold ends (potentially truncated) | 89.72 % |
| % of genes from short scaffolds (< 2000 bps) | 89.72 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.065 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (14.953 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.206 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07589 | PEP-CTERM | 12.15 |
| PF00902 | TatC | 6.54 |
| PF04542 | Sigma70_r2 | 4.67 |
| PF00486 | Trans_reg_C | 2.80 |
| PF01494 | FAD_binding_3 | 2.80 |
| PF14534 | DUF4440 | 2.80 |
| PF01292 | Ni_hydr_CYTB | 1.87 |
| PF08281 | Sigma70_r4_2 | 1.87 |
| PF03781 | FGE-sulfatase | 1.87 |
| PF13442 | Cytochrome_CBB3 | 1.87 |
| PF00072 | Response_reg | 0.93 |
| PF00033 | Cytochrome_B | 0.93 |
| PF13091 | PLDc_2 | 0.93 |
| PF09190 | DALR_2 | 0.93 |
| PF02469 | Fasciclin | 0.93 |
| PF02801 | Ketoacyl-synt_C | 0.93 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF01406 | tRNA-synt_1e | 0.93 |
| PF05199 | GMC_oxred_C | 0.93 |
| PF12770 | CHAT | 0.93 |
| PF04264 | YceI | 0.93 |
| PF12146 | Hydrolase_4 | 0.93 |
| PF13581 | HATPase_c_2 | 0.93 |
| PF04224 | DUF417 | 0.93 |
| PF08713 | DNA_alkylation | 0.93 |
| PF00355 | Rieske | 0.93 |
| PF08448 | PAS_4 | 0.93 |
| PF10099 | RskA | 0.93 |
| PF10282 | Lactonase | 0.93 |
| PF01068 | DNA_ligase_A_M | 0.93 |
| PF01039 | Carboxyl_trans | 0.93 |
| PF02770 | Acyl-CoA_dh_M | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 6.54 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 5.61 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 4.67 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 4.67 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 4.67 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 4.67 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.80 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 2.80 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 2.80 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.87 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.87 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 1.87 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 1.87 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 1.87 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 1.87 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 1.87 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.93 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.93 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.93 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.93 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.93 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.93 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.93 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.93 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 0.93 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.93 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_79341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300000567|JGI12270J11330_10091214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1378 | Open in IMG/M |
| 3300000956|JGI10216J12902_101947914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300002917|JGI25616J43925_10235719 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300004080|Ga0062385_10265902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 964 | Open in IMG/M |
| 3300004080|Ga0062385_10608257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
| 3300004092|Ga0062389_102427617 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300004092|Ga0062389_104456046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 527 | Open in IMG/M |
| 3300004104|Ga0058891_1460982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300004156|Ga0062589_101099857 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005175|Ga0066673_10740678 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005445|Ga0070708_101423841 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005451|Ga0066681_10638680 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005541|Ga0070733_10522677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 794 | Open in IMG/M |
| 3300005542|Ga0070732_10057504 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300005552|Ga0066701_10877907 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005764|Ga0066903_106082211 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005897|Ga0075281_1031913 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006028|Ga0070717_11164880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300006049|Ga0075417_10227963 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006059|Ga0075017_100528841 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300006059|Ga0075017_101361725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300006086|Ga0075019_10225758 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300006102|Ga0075015_101000985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300006176|Ga0070765_101606576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
| 3300006354|Ga0075021_11016302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006800|Ga0066660_11702836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300006904|Ga0075424_101736987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300007004|Ga0079218_10848620 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300009100|Ga0075418_11293869 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009137|Ga0066709_102297785 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009177|Ga0105248_12358973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300009523|Ga0116221_1484540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300009524|Ga0116225_1224372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300009553|Ga0105249_12886679 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009824|Ga0116219_10680324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010339|Ga0074046_10107425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1799 | Open in IMG/M |
| 3300010360|Ga0126372_12566419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300010371|Ga0134125_13017222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300010379|Ga0136449_102420884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300010401|Ga0134121_11533620 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012043|Ga0136631_10012213 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300012046|Ga0136634_10533387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300012092|Ga0136621_1310942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300012093|Ga0136632_10508634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012096|Ga0137389_10101825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2284 | Open in IMG/M |
| 3300012202|Ga0137363_10514606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300012202|Ga0137363_11133886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012363|Ga0137390_10224247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1866 | Open in IMG/M |
| 3300012917|Ga0137395_10246750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300012955|Ga0164298_10601488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300014056|Ga0120125_1072403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300016319|Ga0182033_10833313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300016357|Ga0182032_10415307 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1091 | Open in IMG/M |
| 3300016445|Ga0182038_10241635 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300017656|Ga0134112_10372531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300017996|Ga0187891_1118842 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300018006|Ga0187804_10149158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300018024|Ga0187881_10036400 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300018038|Ga0187855_10176934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300018040|Ga0187862_10877226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella azotifigens | 515 | Open in IMG/M |
| 3300018047|Ga0187859_10020502 | All Organisms → cellular organisms → Bacteria | 3664 | Open in IMG/M |
| 3300018468|Ga0066662_12228338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300019362|Ga0173479_10569572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300019377|Ga0190264_11018020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300020199|Ga0179592_10199404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300020581|Ga0210399_10362166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
| 3300021181|Ga0210388_10080343 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
| 3300025500|Ga0208686_1002386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6933 | Open in IMG/M |
| 3300025938|Ga0207704_10224198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300026121|Ga0207683_10033363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4471 | Open in IMG/M |
| 3300026331|Ga0209267_1334630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300026480|Ga0257177_1034548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300026482|Ga0257172_1099092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300026529|Ga0209806_1266739 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300027394|Ga0209904_1021250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300027655|Ga0209388_1135936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300027783|Ga0209448_10116401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300027812|Ga0209656_10184970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300027854|Ga0209517_10476154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300027898|Ga0209067_10063864 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300027905|Ga0209415_10398619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300028565|Ga0302145_10266208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300028747|Ga0302219_10155864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300028780|Ga0302225_10537762 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 544 | Open in IMG/M |
| 3300028889|Ga0247827_10892797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300029922|Ga0311363_11207316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300029984|Ga0311332_10125099 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300029986|Ga0302188_10175936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300029987|Ga0311334_10110862 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300029999|Ga0311339_10024801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8728 | Open in IMG/M |
| 3300030518|Ga0302275_10469709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300030991|Ga0073994_10054306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300031640|Ga0318555_10419565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300031682|Ga0318560_10151800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1226 | Open in IMG/M |
| 3300031718|Ga0307474_10987144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031754|Ga0307475_10694935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300031847|Ga0310907_10730972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031943|Ga0310885_10186134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300032012|Ga0310902_10434692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 843 | Open in IMG/M |
| 3300032261|Ga0306920_101172311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300032805|Ga0335078_11124589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300032954|Ga0335083_11497257 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300033004|Ga0335084_10692126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300033134|Ga0335073_11444518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300033829|Ga0334854_042263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.67% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01316590 | 2199352024 | Soil | FPLARLWHFLALCGFLSFIPGHLIMVLLHGWQNFYSMLAGWKRDPEYLR |
| JGI12270J11330_100912141 | 3300000567 | Peatlands Soil | WIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE* |
| JGI10216J12902_1019479142 | 3300000956 | Soil | MIHFSALLGFAAFIPGHLFMVALHGWNNFASMLTGWKKDPDYLRSSDSL* |
| JGI25616J43925_102357191 | 3300002917 | Grasslands Soil | HFVAMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE* |
| Ga0062385_102659022 | 3300004080 | Bog Forest Soil | HFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE* |
| Ga0062385_106082571 | 3300004080 | Bog Forest Soil | AMCGFVAFIPGHLIMVVLHGWNNFYSMVTGWKRDPEYLG* |
| Ga0062389_1024276171 | 3300004092 | Bog Forest Soil | AMCGFVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD* |
| Ga0062389_1044560461 | 3300004092 | Bog Forest Soil | AMCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYIE* |
| Ga0058891_14609822 | 3300004104 | Forest Soil | HFAAMCGFLAFIPGHLIMVVLHGWANFYSMFSGWKREPEYQE* |
| Ga0062589_1010998571 | 3300004156 | Soil | AMCGFLAFIPGHLIMVALHGWTNFVSMLVGWKRDPEYHAD* |
| Ga0066673_107406781 | 3300005175 | Soil | AMCGFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRVPLS* |
| Ga0065715_102820801 | 3300005293 | Miscanthus Rhizosphere | GYGLVRGWHFFALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR* |
| Ga0070708_1014238412 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | CGFLAFIPGHLVMVAIHGWDNFQSMLTGWKRHPEYLKPR* |
| Ga0066681_106386802 | 3300005451 | Soil | FAAMCGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD* |
| Ga0070733_105226772 | 3300005541 | Surface Soil | HFAAMCGFLAFIPGHLLMVVLHGWDNFASMLTGWKRNPGYRTPLA* |
| Ga0070732_100575041 | 3300005542 | Surface Soil | GHLIMVVLHGWSNFASMLTGWKRDPEYLPRRSSE* |
| Ga0066701_108779071 | 3300005552 | Soil | WHFAAMCGFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPAS* |
| Ga0066903_1060822113 | 3300005764 | Tropical Forest Soil | LVHFLSMCALLAFIPGHLIMVVLHGWDNFSSILTGWKRHPEYVAVEREP* |
| Ga0075281_10319131 | 3300005897 | Rice Paddy Soil | GFLAFIPGHVIMVVLHGWSNFASMLTGWKRDPEYLSRRSAE* |
| Ga0070717_111648802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IPGHLIMVAIHGWNNFMAMLTGWKRDPEYSDRGAKAGG* |
| Ga0075417_102279631 | 3300006049 | Populus Rhizosphere | LAMCGFLAFIPGHLVMVLLHGWHNFVAMLTGWKRDPEYLKAPVER* |
| Ga0075017_1005288412 | 3300006059 | Watersheds | FAAMCGFLAFIPGHLIMVLLHGWSNFFAMLSGWKRDPEYQE* |
| Ga0075017_1013617252 | 3300006059 | Watersheds | WHFFAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE* |
| Ga0075019_102257581 | 3300006086 | Watersheds | FHLTRLWHFAAMCGFLAFIPGHLIMVVLHGWSNFFSMLSGWKREPEYQE* |
| Ga0075015_1010009851 | 3300006102 | Watersheds | RGWHFAAMCGFLAFIPGHLIMVLLHGWSNFFAMLSGWKRDPEYQE* |
| Ga0070765_1016065762 | 3300006176 | Soil | AMCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPDYQE* |
| Ga0075021_110163021 | 3300006354 | Watersheds | RLWHFAAMCGFLAFIPGHLIMVLLHGWSNVYSMLSGWKREPEYQE* |
| Ga0066660_117028362 | 3300006800 | Soil | CGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD* |
| Ga0075424_1017369872 | 3300006904 | Populus Rhizosphere | VHFVAMCGILGFIPGHLIMVGLHGWDNFVSIFTGWKRHPEYVPLGRKP* |
| Ga0079218_108486202 | 3300007004 | Agricultural Soil | MTHFAAMIGFLSFIPGHLLMVALHGWSNFYSMLTGWKSDPDYFNSRW* |
| Ga0075418_112938691 | 3300009100 | Populus Rhizosphere | FLAMCSFLVFLPGHLIMVALHGWNNFRSMLTGWKRDPDYLKAL* |
| Ga0066709_1022977852 | 3300009137 | Grasslands Soil | LFLSFVPGHLLMVAIHGWDNFYSMMVGWKRDPEYLRKKD* |
| Ga0105248_123589731 | 3300009177 | Switchgrass Rhizosphere | RIWHFLALCGFAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA* |
| Ga0116221_14845401 | 3300009523 | Peatlands Soil | AMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE* |
| Ga0116225_12243722 | 3300009524 | Peatlands Soil | MKGSSGVRWIRICHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE* |
| Ga0105249_128866792 | 3300009553 | Switchgrass Rhizosphere | FVATCGFLAFIPGHLIMVALHGWKNFVSMIVGWKRDSEYHAG* |
| Ga0116219_106803242 | 3300009824 | Peatlands Soil | MKGSSGVRWIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE* |
| Ga0074046_101074251 | 3300010339 | Bog Forest Soil | LARIWHFLAMCGFLAFIPGHLIMVALHGWKNFYSMVTGWKRDPEYWG* |
| Ga0126372_125664192 | 3300010360 | Tropical Forest Soil | RIWHFFSMVGFVAFIPGHLIMVGLHGWNNFYSMITGWKRDPEYVKTVDSK* |
| Ga0134125_130172222 | 3300010371 | Terrestrial Soil | PGHLIMVVLHGWSNFASMLTGWKRDPEYLSRRSTP* |
| Ga0136449_1024208841 | 3300010379 | Peatlands Soil | RLWHFVAMCGFLAFIPGHLVMVVLHGWSNFVSMLVGWKKDPGYLR* |
| Ga0134121_115336202 | 3300010401 | Terrestrial Soil | GFLAFIPGHLIMVAVHGWTNFVSMLVGWKRDPEYRAD* |
| Ga0136631_100122135 | 3300012043 | Polar Desert Sand | MCGFLAFIPGHLLMVAVHGWSNFASMLVGWKKDPEYGAPE |
| Ga0136634_105333871 | 3300012046 | Polar Desert Sand | RLIHFLSMCGLLAFIPGHLIMVLLHGWDNFASMVTGWKRYPEYTSGNKS* |
| Ga0136621_13109422 | 3300012092 | Polar Desert Sand | MCGFLAFTPGHLVMVALHGWNNFASMLVGWKKDPEYGKPETLR* |
| Ga0136632_105086341 | 3300012093 | Polar Desert Sand | MCGFLAFIPGHLVMVGLHGWNNFVSMLVGWKKTQSTG |
| Ga0137389_101018251 | 3300012096 | Vadose Zone Soil | GFLAFIPGHLIMVAIHGWNNFMAMLTGWKRDPEYVKPGDVSGD* |
| Ga0137363_105146063 | 3300012202 | Vadose Zone Soil | LAFIPGHLIMVALHGWANFYSMLSGWKREPEYQE* |
| Ga0137363_111338861 | 3300012202 | Vadose Zone Soil | MYGLLAFIPGHLVMVALHGWDNFASMLTGWKRHPEYTPSQEAR* |
| Ga0137390_102242474 | 3300012363 | Vadose Zone Soil | MCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE* |
| Ga0137395_102467503 | 3300012917 | Vadose Zone Soil | WHFAAMCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE* |
| Ga0164298_106014882 | 3300012955 | Soil | FALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR* |
| Ga0120125_10724033 | 3300014056 | Permafrost | MCGFLAFIPGHLIMVLLHGWNNFYSMVTGWKRDPEYLG* |
| Ga0182033_108333133 | 3300016319 | Soil | FIPGHLIMVVLHGWDNFASMITGWKRHPEYVAAEREP |
| Ga0182032_104153071 | 3300016357 | Soil | MVRLGHFLAMCGLLAFIPGHLPLVALHGWNNCRAMLDGYKREPEYLE |
| Ga0182038_102416351 | 3300016445 | Soil | FLAMCGLLAFIPGHLLIVALHGWNNCRAMLDGYKREPEYLE |
| Ga0134112_103725313 | 3300017656 | Grasslands Soil | GFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPTS |
| Ga0187891_11188421 | 3300017996 | Peatland | RIWHFAAMCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPEYQE |
| Ga0187804_101491582 | 3300018006 | Freshwater Sediment | FAVMAGLLFFIVGHLIMVVLHGWRNFASMLTGWKRDPEYPV |
| Ga0187881_100364001 | 3300018024 | Peatland | FVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD |
| Ga0187855_101769341 | 3300018038 | Peatland | AMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE |
| Ga0187862_108772261 | 3300018040 | Peatland | IWHFVAMCGFVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD |
| Ga0187859_100205021 | 3300018047 | Peatland | WHFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE |
| Ga0066662_122283383 | 3300018468 | Grasslands Soil | MCGFLAFIPGHLIMVLLHGWNNFYSMLAGWKRDPEYL |
| Ga0173479_105695721 | 3300019362 | Soil | HFFALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR |
| Ga0190264_110180202 | 3300019377 | Soil | FAAFVPGHLVMVAIHGWQNFASMLTGWKRNPEYLRSRGS |
| Ga0179592_101994041 | 3300020199 | Vadose Zone Soil | CGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Ga0210399_103621662 | 3300020581 | Soil | VWHFAATCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Ga0210388_100803434 | 3300021181 | Soil | MCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPEYQE |
| Ga0208686_10023869 | 3300025500 | Peatland | MWHFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE |
| Ga0207704_102241984 | 3300025938 | Miscanthus Rhizosphere | VPGHLVMVALHGWENFVAMLTGWKRDPEYLGRKGA |
| Ga0207683_100333636 | 3300026121 | Miscanthus Rhizosphere | VRIWHFLALCGFAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA |
| Ga0209267_13346302 | 3300026331 | Soil | FIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPAS |
| Ga0257177_10345481 | 3300026480 | Soil | FAAMCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE |
| Ga0257172_10990922 | 3300026482 | Soil | GFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Ga0209806_12667392 | 3300026529 | Soil | VWHFAAMCGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD |
| Ga0209904_10212502 | 3300027394 | Thawing Permafrost | MCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPGYQE |
| Ga0209388_11359361 | 3300027655 | Vadose Zone Soil | LVHFLAMCGLLAFIPGHLMMVALHGWDNFTSMLTGWKRRPEYEPQRSER |
| Ga0209448_101164013 | 3300027783 | Bog Forest Soil | MCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKRDPEYQE |
| Ga0209656_101849703 | 3300027812 | Bog Forest Soil | FAAMCGFLAFIPGHLLMVVLHGWSNFFSMLSGWKREPEYQE |
| Ga0209517_104761541 | 3300027854 | Peatlands Soil | MKGSSGVRWIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE |
| Ga0209067_100638642 | 3300027898 | Watersheds | FHLTRLWHFAAMCGFLAFIPGHLIMVVLHGWSNFFSMLSGWKREPEYQE |
| Ga0209415_103986193 | 3300027905 | Peatlands Soil | FVAMCGFLAFIPGHLVMVVLHGWSNFASMLVGWKKDPEYLR |
| Ga0302145_102662081 | 3300028565 | Bog | IWHFAAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE |
| Ga0302219_101558641 | 3300028747 | Palsa | WHFAAMCGFLAFIPGHLIMVALHGWANFFSMFSGWKREPEYQE |
| Ga0302225_105377621 | 3300028780 | Palsa | CGFVAFIPGHLIMVSLHGWNNFYSMLTGYKRDPEYID |
| Ga0247827_108927972 | 3300028889 | Soil | FAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA |
| Ga0311363_112073161 | 3300029922 | Fen | ISMCGFVAFIPGHLIMVLLHGWNNFYSMITGWKRDPEYLD |
| Ga0311332_101250996 | 3300029984 | Fen | FLSFIPGHLIMVVLHGWSNFMSMLSGWKREPEYQE |
| Ga0302188_101759361 | 3300029986 | Bog | AAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE |
| Ga0311334_101108621 | 3300029987 | Fen | MCGFVSFIPGHLLMVALHGWNNFYSMLTGWKKNPDYLAK |
| Ga0311339_100248011 | 3300029999 | Palsa | CGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE |
| Ga0302275_104697091 | 3300030518 | Bog | WHFAAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE |
| Ga0073994_100543061 | 3300030991 | Soil | AAMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Ga0318555_104195653 | 3300031640 | Soil | RLVHFLSMCALLAFIPGHLIMVVLHGWDNFASILTGWKRHPEYVAVEREP |
| Ga0318560_101518003 | 3300031682 | Soil | CALLAFIPGHLIMVVLHGWDNFASILTGWKRHPEYVAVEREP |
| Ga0307474_109871441 | 3300031718 | Hardwood Forest Soil | GVLCAFVLFVLGHLVMVILHGWNNFTSMLTGWKRDPEYLQ |
| Ga0307475_106949354 | 3300031754 | Hardwood Forest Soil | AMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE |
| Ga0310907_107309721 | 3300031847 | Soil | VPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA |
| Ga0310885_101861342 | 3300031943 | Soil | FLAMCGFLAFIPGHLIMVVLHGWKNFVSMLVGWKRDPEYHAD |
| Ga0310902_104346921 | 3300032012 | Soil | NARTIHFLAMCGMLAFIPGHLVMVALHGWDNFASMVTGWKRHPEYVVGSK |
| Ga0306920_1011723113 | 3300032261 | Soil | MCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYLGGRPNLR |
| Ga0335078_111245892 | 3300032805 | Soil | ISMCGFLAFIPGHLIMVALHGWNNFYSMLTGWKRDPEYRG |
| Ga0335083_114972571 | 3300032954 | Soil | MCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYIDRA |
| Ga0335084_106921261 | 3300033004 | Soil | MCGFVAFIPGHLVMVVLHGWNNFYSMITGWKRDPEYLR |
| Ga0335073_114445181 | 3300033134 | Soil | FVAFIPGHLIMVGLHGWNNFYSMITGWKHDPEYVE |
| Ga0334854_042263_17_133 | 3300033829 | Soil | MCGFLAFIPGHLIMVALHGWANFFSMFSGWKREPEYQE |
| ⦗Top⦘ |