


| Basic Information | |
|---|---|
| Family ID | F092383 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSIRIVPAILAAAVSVAFGFPPANAQQKPQPPQSLRLYVLDCGI |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.13 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 94.39 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.290 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.430 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.94% β-sheet: 0.00% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 4.67 |
| PF00903 | Glyoxalase | 3.74 |
| PF08450 | SGL | 3.74 |
| PF03992 | ABM | 2.80 |
| PF00496 | SBP_bac_5 | 1.87 |
| PF04392 | ABC_sub_bind | 1.87 |
| PF05378 | Hydant_A_N | 1.87 |
| PF00248 | Aldo_ket_red | 1.87 |
| PF00753 | Lactamase_B | 1.87 |
| PF02604 | PhdYeFM_antitox | 0.93 |
| PF01979 | Amidohydro_1 | 0.93 |
| PF13592 | HTH_33 | 0.93 |
| PF01522 | Polysacc_deac_1 | 0.93 |
| PF00596 | Aldolase_II | 0.93 |
| PF01828 | Peptidase_A4 | 0.93 |
| PF00133 | tRNA-synt_1 | 0.93 |
| PF06035 | Peptidase_C93 | 0.93 |
| PF00144 | Beta-lactamase | 0.93 |
| PF00701 | DHDPS | 0.93 |
| PF05973 | Gp49 | 0.93 |
| PF00857 | Isochorismatase | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 3.74 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 3.74 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 3.74 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.87 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.93 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.93 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.93 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.29 % |
| Unclassified | root | N/A | 32.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11842190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300005171|Ga0066677_10598600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300005332|Ga0066388_105137546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 664 | Open in IMG/M |
| 3300005332|Ga0066388_105676107 | Not Available | 631 | Open in IMG/M |
| 3300005332|Ga0066388_106051982 | Not Available | 611 | Open in IMG/M |
| 3300005575|Ga0066702_10386458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 853 | Open in IMG/M |
| 3300005576|Ga0066708_10985758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300005719|Ga0068861_100471031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300005764|Ga0066903_101137436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1443 | Open in IMG/M |
| 3300005764|Ga0066903_102635515 | Not Available | 975 | Open in IMG/M |
| 3300005764|Ga0066903_105827275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300006032|Ga0066696_10621904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis | 700 | Open in IMG/M |
| 3300006047|Ga0075024_100794676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300006050|Ga0075028_100743038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300006162|Ga0075030_101178790 | Not Available | 602 | Open in IMG/M |
| 3300006176|Ga0070765_102014324 | Not Available | 540 | Open in IMG/M |
| 3300006800|Ga0066660_10422879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium alhagi | 1106 | Open in IMG/M |
| 3300006844|Ga0075428_100447268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
| 3300006954|Ga0079219_10636794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300007255|Ga0099791_10073636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1551 | Open in IMG/M |
| 3300009098|Ga0105245_10248926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300009525|Ga0116220_10104525 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300009683|Ga0116224_10051308 | Not Available | 2014 | Open in IMG/M |
| 3300009792|Ga0126374_11147123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010359|Ga0126376_10606967 | Not Available | 1036 | Open in IMG/M |
| 3300010359|Ga0126376_11583800 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010360|Ga0126372_12771060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010361|Ga0126378_11840586 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010362|Ga0126377_11308337 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010362|Ga0126377_11880058 | Not Available | 674 | Open in IMG/M |
| 3300010362|Ga0126377_12566785 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010366|Ga0126379_10931374 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300010366|Ga0126379_11676599 | Not Available | 740 | Open in IMG/M |
| 3300010403|Ga0134123_10670716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1009 | Open in IMG/M |
| 3300011270|Ga0137391_10383643 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300011271|Ga0137393_11323620 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300011423|Ga0137436_1133663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300012096|Ga0137389_10322780 | Not Available | 1310 | Open in IMG/M |
| 3300012189|Ga0137388_11041817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300012202|Ga0137363_10243057 | Not Available | 1461 | Open in IMG/M |
| 3300012205|Ga0137362_10373294 | Not Available | 1235 | Open in IMG/M |
| 3300012351|Ga0137386_11043402 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012351|Ga0137386_11108315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012361|Ga0137360_11464915 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012362|Ga0137361_10592125 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300012683|Ga0137398_10972525 | Not Available | 589 | Open in IMG/M |
| 3300012922|Ga0137394_10968947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300012927|Ga0137416_10439950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300012927|Ga0137416_10933078 | Not Available | 773 | Open in IMG/M |
| 3300012927|Ga0137416_12149780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012930|Ga0137407_10824482 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012971|Ga0126369_10046208 | Not Available | 3691 | Open in IMG/M |
| 3300012971|Ga0126369_13488573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300013297|Ga0157378_11971786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300015242|Ga0137412_11086108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300015245|Ga0137409_10438781 | Not Available | 1124 | Open in IMG/M |
| 3300015264|Ga0137403_10495145 | Not Available | 1094 | Open in IMG/M |
| 3300016270|Ga0182036_10560367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 912 | Open in IMG/M |
| 3300016270|Ga0182036_11049040 | Not Available | 673 | Open in IMG/M |
| 3300016294|Ga0182041_11911518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300016319|Ga0182033_11668254 | Not Available | 577 | Open in IMG/M |
| 3300016371|Ga0182034_11215270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300016371|Ga0182034_11546348 | Not Available | 582 | Open in IMG/M |
| 3300016422|Ga0182039_11546142 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300016422|Ga0182039_11636168 | Not Available | 588 | Open in IMG/M |
| 3300017822|Ga0187802_10246199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300017930|Ga0187825_10404196 | Not Available | 525 | Open in IMG/M |
| 3300017959|Ga0187779_10305820 | Not Available | 1018 | Open in IMG/M |
| 3300017997|Ga0184610_1102782 | Not Available | 907 | Open in IMG/M |
| 3300018066|Ga0184617_1272035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300018086|Ga0187769_10835434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300018088|Ga0187771_11066825 | Not Available | 685 | Open in IMG/M |
| 3300021401|Ga0210393_11132962 | Not Available | 631 | Open in IMG/M |
| 3300021420|Ga0210394_11809890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021474|Ga0210390_10523285 | Not Available | 998 | Open in IMG/M |
| 3300021477|Ga0210398_11058225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300021560|Ga0126371_12368870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
| 3300025926|Ga0207659_11302691 | Not Available | 624 | Open in IMG/M |
| 3300026121|Ga0207683_10330289 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 1398 | Open in IMG/M |
| 3300026359|Ga0257163_1005281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1848 | Open in IMG/M |
| 3300027903|Ga0209488_10067862 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300027903|Ga0209488_10567900 | Not Available | 826 | Open in IMG/M |
| 3300027905|Ga0209415_10342111 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300027911|Ga0209698_11024417 | Not Available | 615 | Open in IMG/M |
| 3300028536|Ga0137415_10024355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5983 | Open in IMG/M |
| 3300028536|Ga0137415_11021329 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300030524|Ga0311357_10148454 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300031234|Ga0302325_10148070 | All Organisms → cellular organisms → Bacteria | 4209 | Open in IMG/M |
| 3300031543|Ga0318516_10100823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1632 | Open in IMG/M |
| 3300031572|Ga0318515_10636685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300031719|Ga0306917_10571430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 889 | Open in IMG/M |
| 3300031740|Ga0307468_101332839 | Not Available | 655 | Open in IMG/M |
| 3300031753|Ga0307477_10520397 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031771|Ga0318546_11328193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031890|Ga0306925_10784722 | Not Available | 990 | Open in IMG/M |
| 3300031910|Ga0306923_11211975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300031910|Ga0306923_11298993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300032001|Ga0306922_11790038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300032060|Ga0318505_10493178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300032076|Ga0306924_11501062 | Not Available | 715 | Open in IMG/M |
| 3300032076|Ga0306924_12140266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300032160|Ga0311301_11016958 | Not Available | 1093 | Open in IMG/M |
| 3300032205|Ga0307472_102468881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300032515|Ga0348332_13159334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis | 512 | Open in IMG/M |
| 3300033289|Ga0310914_10983610 | Not Available | 744 | Open in IMG/M |
| 3300033433|Ga0326726_11234018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 727 | Open in IMG/M |
| 3300034090|Ga0326723_0563106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.87% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_118421903 | 3300000550 | Soil | MSIRIVPVILMAAVSVAFGFSPANAQQPQPPQSPRLYVLDCGIITP |
| Ga0066677_105986002 | 3300005171 | Soil | MSIRIVPAILAAAVSVAFGFSPVNAQQPQLSQSLRLYVLDCGIITPPNV |
| Ga0066388_1051375461 | 3300005332 | Tropical Forest Soil | MSIRTVPYILAAAAFVAFGFPPANAQQKPQPPQSLRLYVLDCGII |
| Ga0066388_1056761071 | 3300005332 | Tropical Forest Soil | MSIRIVHTILAAVALSFTSADAQPAKPQPPQSLRLYVLDCGII |
| Ga0066388_1060519821 | 3300005332 | Tropical Forest Soil | MSIGIMPIRIASAILLAAVSAAVGVPPANAQQPQPPQSLRLYVL |
| Ga0066702_103864581 | 3300005575 | Soil | MSIVSYVLAAAVSVAFGSLTANAQQPQNPQPPQSLRLYVLDCGKITPAVP |
| Ga0066708_109857581 | 3300005576 | Soil | MSIRIMSIRIVPAILAAAVSVVFGFPPANAQQPQKPQPPQSLRLYVLDCGI |
| Ga0068861_1004710312 | 3300005719 | Switchgrass Rhizosphere | MPIRIVPAILAVALSVVFGFPTANAQQPQRPQPVQSLRLYVL |
| Ga0066903_1011374361 | 3300005764 | Tropical Forest Soil | MTVHIVPAILAAAVSVACGFLPAQAQQTQPPQSLRLYVLDCGIITPPTSTTTA* |
| Ga0066903_1026355151 | 3300005764 | Tropical Forest Soil | MSIRTVPSILAAAAVFTAFGVPSANAQQKAQPPQSLRL |
| Ga0066903_1058272751 | 3300005764 | Tropical Forest Soil | MSMRTMSIRIVPAILAAAASVAFGFAPANAQQPQPPQSLRLYVLDCGIIT |
| Ga0066696_106219041 | 3300006032 | Soil | MSIHIVLAILAAAVSVAFGFPPANAQQPQKPQPPQSLRLYVLDCGIITP |
| Ga0075024_1007946761 | 3300006047 | Watersheds | MSIRIVPAILAASVSVAFGFPPANAQQPQKPQPPQSLRLYVL |
| Ga0075028_1007430382 | 3300006050 | Watersheds | MSIRIVPAILAAAMSVAFCFPPANAQQPQGPQPPQSLRLYVLDCGK |
| Ga0075030_1011787901 | 3300006162 | Watersheds | MSIRIVPAVLAAAVFVAFGFPLANAQQPPAPQPPQSLRLYVLDCGII |
| Ga0070765_1020143242 | 3300006176 | Soil | MSVRTVPCILAAVFMAFGFPPADAQQKPQPPQSLRLYVLDCG |
| Ga0066660_104228793 | 3300006800 | Soil | MSIRIVSAIVVAAVSMVFGFTPASAQKPPSPQTLRLYVLDC |
| Ga0075428_1004472681 | 3300006844 | Populus Rhizosphere | MSIRIVTAVLAAALCVALNFPPAFAQQPQRPQPPQSLRLYVLDCG |
| Ga0079219_106367942 | 3300006954 | Agricultural Soil | MSHRLVLAILAAAFLALGFLPVNAQAQKAQSPQSLRLYVLDCG |
| Ga0099791_100736363 | 3300007255 | Vadose Zone Soil | MFVREDPMSLRIVPAILAVAVSVAFGLLPVNAQQAQRPQSAQSLRLYVLDC |
| Ga0105245_102489261 | 3300009098 | Miscanthus Rhizosphere | MPIRIVPAILAVALSVVFGFPTANAQQPQRPQPVQSPRLYVLDCGKITPANVD |
| Ga0116220_101045252 | 3300009525 | Peatlands Soil | MSTRTVPYILAAAAFVAFGFPPANAQQKPQPPQSLRLYVFDCGIITPANVD |
| Ga0116224_100513081 | 3300009683 | Peatlands Soil | MSIRIVPAILAAAMLVAFGFPTANAQQKPQPPQSLRLYVLDCGIITP |
| Ga0126374_111471231 | 3300009792 | Tropical Forest Soil | MSIRIVPAILVTAVSVAFGFPPANAQQAQKPQPPQSLRLYILDCGKITPATPGEAY |
| Ga0126376_106069671 | 3300010359 | Tropical Forest Soil | MSTRIVPAILAAGVSLAFGFPQANAQQNPQPPQSLRLYVLD |
| Ga0126376_115838002 | 3300010359 | Tropical Forest Soil | MSIRIVPAILAAAMSVAFGSPPANAQQPQKPQPPQSLRLYVLD |
| Ga0126372_127710601 | 3300010360 | Tropical Forest Soil | MSIRIVPYILAAVAFMAFGFPPTNAQQKPQPPQSLRLYVLDCGIITP |
| Ga0126378_118405862 | 3300010361 | Tropical Forest Soil | MSIRIVPYILAAVAFMAFGFPPTNAQQKPQPPQSLR |
| Ga0126377_113083372 | 3300010362 | Tropical Forest Soil | MSIRIVPAILAAAMSVAFGSPPANAQQPQKPQPPQSLRLYVLDCGKITP |
| Ga0126377_118800581 | 3300010362 | Tropical Forest Soil | MSIRIVSAILVAAVSVAFGFTLAGAQQPQRPQPPQSLRLYVLDCG |
| Ga0126377_125667852 | 3300010362 | Tropical Forest Soil | MSIRIVPYILAAVAFMAFGFPPTNAQQKPQPPQSLRLYVLDCG |
| Ga0126379_109313742 | 3300010366 | Tropical Forest Soil | MSIRTMPYILAAVAFMAFGFPPTNAQQKSQPPQSLRLYVLDCGIITPPNVDN |
| Ga0126379_116765992 | 3300010366 | Tropical Forest Soil | MSIRTVPAILAAAVFVAFGFPPAKAQQPQKPQPPQSLRLYVL |
| Ga0134123_106707161 | 3300010403 | Terrestrial Soil | MSIRSVPAILAVALSVVFGFPPANAQQAQRPQPPQSLRLYVLDCGK |
| Ga0137391_103836431 | 3300011270 | Vadose Zone Soil | MSIRIVPAILAAAVSVAFGFPSANAQQPQKPQPPQSLRLYV |
| Ga0137393_113236201 | 3300011271 | Vadose Zone Soil | MPIRTVPCILTAAVLMAFGFPPANAQQPQKPQPPQSLRLYVLD |
| Ga0137436_11336632 | 3300011423 | Soil | MSIRIVPAILAAAVSVAFGFSPANAQQPQPPQSLRLYVLDCGIITPPNVD |
| Ga0137389_103227802 | 3300012096 | Vadose Zone Soil | MSIRTVPAILAAAVFMAFGFPPANAQQKPQPPQSLRLYVLDCGIIT |
| Ga0137388_110418171 | 3300012189 | Vadose Zone Soil | MSIRTMPYILAAAMFGAFGFPPTNAQQKPQPPQSLRLYVLDCGIITP |
| Ga0137363_102430571 | 3300012202 | Vadose Zone Soil | MSIRTVPYILAAAVFVAFGSPPTNAQQKPQPPQSLRLY |
| Ga0137362_103732942 | 3300012205 | Vadose Zone Soil | MSIRTVPAILAAAVFMAFGFPPANAQQQQKPQPPQSLRL |
| Ga0137386_110434022 | 3300012351 | Vadose Zone Soil | MPSPIVLAILATAVSVAFGFPPANAQQLPQPPQSLRLYVLDCGIITP |
| Ga0137386_111083152 | 3300012351 | Vadose Zone Soil | MSIRIVPAILAAAVWVAFGFSPANAQQPQPPQSLRLYVLD |
| Ga0137360_114649152 | 3300012361 | Vadose Zone Soil | MSIRIVPAILAAAVSAAFGFTPANAQQPQPPQSPRLYVLDCGIITPPNVDN |
| Ga0137361_105921251 | 3300012362 | Vadose Zone Soil | MSIRAVPAILAAAVFVAFGFSPASAQQPQKPQPPQSLRLYVLDCG |
| Ga0137398_109725251 | 3300012683 | Vadose Zone Soil | MSIRTMPYILAVAVFVAFGFPPANAQQKPQPPQSLRLYVLD |
| Ga0137394_109689472 | 3300012922 | Vadose Zone Soil | MSIRIVPAILAAAISVAFGFPSANAQQPQKPQPPQSLRLYVLD |
| Ga0137416_104399502 | 3300012927 | Vadose Zone Soil | MKRFVREDSMSIRIVPAILAAAVSAAFGFTPANAQQPQPPQSPRLYVLDCGIIT |
| Ga0137416_109330781 | 3300012927 | Vadose Zone Soil | MSIRTVPAILAAAVFMAFGFPPANAQQPQPPQSLRLYVLDCG |
| Ga0137416_121497802 | 3300012927 | Vadose Zone Soil | MFVREDPMSLRIVPAILAVALSVAFGLLPVNAQQAQRPQSPQSLRLYVVDCGIITPA |
| Ga0137407_108244822 | 3300012930 | Vadose Zone Soil | MSIRIVPAILAAAVSVAFGFSPANAQQPQPPQSLRLYVLDCGI |
| Ga0126369_100462081 | 3300012971 | Tropical Forest Soil | MSIGITSTRIVPAILMAAVSVAFGFPQANAQQNPQPPQSLRLYVLDCGIITP |
| Ga0126369_134885732 | 3300012971 | Tropical Forest Soil | MSVRTVPFILAAAVFMASGFPAANAQQKPQPPQSLRLYVLDCGIITPPNVDN |
| Ga0157378_119717861 | 3300013297 | Miscanthus Rhizosphere | MSLRTVSALLAAAVSVAFGLLPVNAQQAQRPQPQQSLRLYVLDCGIITP |
| Ga0137412_110861081 | 3300015242 | Vadose Zone Soil | MSIRIVPAILAAAVSVAFGFPSANAQQPQRPQPPQSLRLYVLDCGRITPANVD |
| Ga0137409_104387812 | 3300015245 | Vadose Zone Soil | MSIRIVPAILAAAVSVAFGFPSANAQQPQKPQPPQSLRLCVLDCGIITPASVEAY |
| Ga0137403_104951452 | 3300015264 | Vadose Zone Soil | MSIRIVSAILTAAVSVAFGFSPANAQQPQPPQSLRLYVLDCGIITPPNLDN |
| Ga0182036_105603671 | 3300016270 | Soil | MSIRIVPAILAAAVSVAFGFPPANAQPAQKPQPPQSLRL |
| Ga0182036_110490401 | 3300016270 | Soil | MSNRTVPATLAAVMFMALGFPAADAQPKPQPPQSVRLYV |
| Ga0182041_119115182 | 3300016294 | Soil | MSIRTVPTILAAALFVAFGVPPATAQQKPQPPQSLRLYVLDCGKITPA |
| Ga0182033_116682542 | 3300016319 | Soil | MSIRIVPAILAAAVCFGLPLANAQPAKPQPPQSLRLYVLDC |
| Ga0182034_112152701 | 3300016371 | Soil | MSIRTVPTILAAALFVAFGLPSANAQQKPQPPQSLRLYVLDCGKITP |
| Ga0182034_115463481 | 3300016371 | Soil | MSIRIVPAILAAAVSAAFGFPASAQQPQKPQPPQSL |
| Ga0182039_115461422 | 3300016422 | Soil | MSVRTVPFILAAAVFVAPGFPAANAQQKPQPPQSLRLYVLDCG |
| Ga0182039_116361683 | 3300016422 | Soil | MSIRIVPTILAAAVSAVFGFPPADAQQPARPQTPQSLRLSVLDCGKI |
| Ga0187802_102461992 | 3300017822 | Freshwater Sediment | MSVRTVPYIVAVAVFVAFGFPPANAQQKPQPPQSL |
| Ga0187825_104041961 | 3300017930 | Freshwater Sediment | MSLRIQLASIAAVVSVVFGLLPVNAQNQKPPPPQSLRLYVLDCGII |
| Ga0187779_103058201 | 3300017959 | Tropical Peatland | MSLRFVSAILVAALCVAFGFLPVNAQPQKPQPPQSLR |
| Ga0184610_11027821 | 3300017997 | Groundwater Sediment | MSIRIVSAILTAAVSVVFGFSPANAQQPQPPQSLRLYVL |
| Ga0184617_12720351 | 3300018066 | Groundwater Sediment | MSIRIMSAILMAAVFVAFGFSPANAQQPQPPQSLRLYVLDCGII |
| Ga0187769_108354342 | 3300018086 | Tropical Peatland | MSIRTVPAILAAAVFVAFGFAPANAQQPQKPQPPQSLRLYVL |
| Ga0187771_110668252 | 3300018088 | Tropical Peatland | MSIRIAPAILAAAVAFGFPSADAQPKPQPPQSLRLYVLDC |
| Ga0210393_111329621 | 3300021401 | Soil | MSIRIVPAILAAAVSVALGFPPANAQQPQKPQPPQALRLYVLD |
| Ga0210394_118098901 | 3300021420 | Soil | MSLRILPAILAAAVSVAFGLLPVNAQPQKPQPPQSLRLYVLDCGIIPPPTV |
| Ga0210390_105232851 | 3300021474 | Soil | MSIRIVPAILAAAVSVALGFPLANAQQPQKPQPPQSLRLY |
| Ga0210398_110582252 | 3300021477 | Soil | MSIRFAPAILAAAVSLAFGLLPANAQQTPQPPQSLR |
| Ga0126371_123688702 | 3300021560 | Tropical Forest Soil | MSIRTVPHILAAAVFVAFGFPPADAQQQPQKPQPPQSLRLYVLDCGK |
| Ga0207659_113026911 | 3300025926 | Miscanthus Rhizosphere | MSLRIVPAIVALAVSVALGLLPVNAQQAQRPQTQQSLRL |
| Ga0207683_103302893 | 3300026121 | Miscanthus Rhizosphere | MSLRIVPAIVALAVSVALGLLPVNAQQAQRPQTQQSLRLYVLD |
| Ga0257163_10052812 | 3300026359 | Soil | MSIRTVPYILAAAVFVAFGFPPANAQQKPQPPQSLRLYVLDCGKITP |
| Ga0209488_100678621 | 3300027903 | Vadose Zone Soil | MSIRIVPCILAAAVFVAFGFPPANAQQKPQPPQSLRLYVLDCGIITPA |
| Ga0209488_105679002 | 3300027903 | Vadose Zone Soil | MSIRTVPAILAAAVFMAFGFPPANAQQKPQPPQSLRLYVLDCGIITPA |
| Ga0209415_103421111 | 3300027905 | Peatlands Soil | MSTRTVPYILAAAAFVAFGFPPANAQQKPQPPQSLRLYVLDCGII |
| Ga0209698_110244171 | 3300027911 | Watersheds | MSIRIVPAVLAAAVFVAFGFPLANAQQPPAPQPPQSLRLYVLDCGIIT |
| Ga0137415_100243556 | 3300028536 | Vadose Zone Soil | MSIRTVPCILTAAVLMAFGFPPANAQQPQKPQPPQSLRLYV |
| Ga0137415_110213291 | 3300028536 | Vadose Zone Soil | MSIRIVFVMLVAAVSVAFGFMPANAQQPQRAQPPQSLRLYVLDCGGCA |
| Ga0311357_101484541 | 3300030524 | Palsa | MSMRIVPAILAAAVCVAFGFPPADAQQSQKPQPPQSL |
| Ga0302325_101480705 | 3300031234 | Palsa | MSMRIVPAILAAAVCVAFGFPPADAQQLQKPQPPQSLRLYVLDCGKITPAS |
| Ga0318516_101008233 | 3300031543 | Soil | MSVRTVPFILAAAVFVAPGFPAANAQQKPQPPQSLRLYVLDCGIITPP |
| Ga0318515_106366851 | 3300031572 | Soil | MTVRIVPAILAAAVSVACGFLPAQAQQTQPPQSLRLYVLDCGIITPPTSTTTA |
| Ga0306917_105714301 | 3300031719 | Soil | MSIRTVPTILAAALFVAFGLPSANAQQKPQPPQSL |
| Ga0307468_1013328392 | 3300031740 | Hardwood Forest Soil | MRIRFVPAILAAAVSVAVAFSANAQQPQPPQSLRIYILDC |
| Ga0307477_105203972 | 3300031753 | Hardwood Forest Soil | MSLRILPAILATAVSVAFGLLPVNAQPQKPQPPQSLRLYVLDCGIITPPNVDN |
| Ga0318546_113281931 | 3300031771 | Soil | MSIRIVPAILAAAVSVAFFPPANAQQPQKPQPPQSLRLYVLDCGIIT |
| Ga0306925_107847222 | 3300031890 | Soil | MSIRTVPATLAAVMFMALGFPAADAQPKPQPPQSVRL |
| Ga0306923_112119752 | 3300031910 | Soil | MTVHIVPAILAAAVSVACGFLPAQAQQTQPPQSLRLYVLDCGIITPPTSTTTA |
| Ga0306923_112989932 | 3300031910 | Soil | MSIRTVPTILAAALFVAFGLPSANAQQKPQPPQSLRLYVLDCGKITPA |
| Ga0306922_117900383 | 3300032001 | Soil | MSTRIAPAILAAAVAFGFPSAKAQQKPQPPQSLRLYVLDCGKITPATVENY |
| Ga0318505_104931781 | 3300032060 | Soil | MSIHIVRSILAAAVFVALGFPPASAQQPRTPQPPQSLRLYVLDCGIITPPN |
| Ga0306924_115010622 | 3300032076 | Soil | MSIRTVPATLAAVMFMALGFPAADAQPKPQPPQSVRLYVLDCGIIT |
| Ga0306924_121402661 | 3300032076 | Soil | MSIRIVPAILAAAVSAAFGFPASAQQPQKPQPPQSLRLYVLDCGIITPASPGESF |
| Ga0311301_110169581 | 3300032160 | Peatlands Soil | MSIRDSMSISIVPAILAAVVFVAFGFAPANAQQPQRPQPPQSLRLYVLDCGKIT |
| Ga0307472_1024688811 | 3300032205 | Hardwood Forest Soil | MSIRIVPAILAAAVSVAFGFPPANAQQKPQPPQSLRLYVLDCGI |
| Ga0348332_131593342 | 3300032515 | Plant Litter | MSIRTVPYILAAAAFVAFGVPPADAQQKPQPPQSL |
| Ga0310914_109836101 | 3300033289 | Soil | MSIRIVLAILAAAASVAFGFSPANAQPQPPQSLRLYVLDCGKI |
| Ga0326726_112340181 | 3300033433 | Peat Soil | MSLRVVSAILAVAVSVAFGLLPVDAQQAQRPQSPQSLRLYVLD |
| Ga0326723_0563106_386_526 | 3300034090 | Peat Soil | MSIRIVSAILAAAVSVAFGFLPVNAQQAQKPQPSQSLRLYVLDCGII |
| ⦗Top⦘ |