| Basic Information | |
|---|---|
| Family ID | F092351 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKLEDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKINDK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 16.82 % |
| % of genes from short scaffolds (< 2000 bps) | 69.16 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.458 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.374 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13920 | zf-C3HC4_3 | 5.61 |
| PF04851 | ResIII | 4.67 |
| PF00313 | CSD | 2.80 |
| PF01192 | RNA_pol_Rpb6 | 0.93 |
| PF13639 | zf-RING_2 | 0.93 |
| PF01363 | FYVE | 0.93 |
| PF00090 | TSP_1 | 0.93 |
| PF10755 | DUF2585 | 0.93 |
| PF00382 | TFIIB | 0.93 |
| PF00268 | Ribonuc_red_sm | 0.93 |
| PF13518 | HTH_28 | 0.93 |
| PF00132 | Hexapep | 0.93 |
| PF00013 | KH_1 | 0.93 |
| PF13584 | BatD | 0.93 |
| PF03031 | NIF | 0.93 |
| PF13419 | HAD_2 | 0.93 |
| PF00397 | WW | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.93 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.93 |
| COG5190 | TFIIF-interacting CTD phosphatase, includes NLI-interacting factor | Transcription [K] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.46 % |
| All Organisms | root | All Organisms | 6.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 23.36% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.48% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 5.61% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.67% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.74% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.80% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.93% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.93% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.93% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS312G0146KB_00360690 | 2189573027 | Marine Estuarine | MKFQIEDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKINDIS |
| BBAY92_100112462 | 3300000947 | Macroalgal Surface | MKFQIDNFIDFHVLFMTICILIAYEYIMNSSNIIIEKNK* |
| GOS2245_10865694 | 3300001966 | Marine | MKFQIEDFIDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKLKNK* |
| GOS2216_100981062 | 3300001972 | Marine | MKIDDFIDYHTLFMTMCIVIAYRYITTDTNIILEKNIQ* |
| Ga0073579_12883712 | 3300005239 | Marine | MKFQIEDFIDFHVLFMTICVLIAYEYIMNGTNIIVEKKLN* |
| Ga0066849_100818711 | 3300005430 | Marine | MKFQIDDFIDFHVLFMTICILIAYEYIMNGSNIIIEKKLNDKL* |
| Ga0076919_103590216 | 3300005731 | M | MKFQIEDFIDFHVFFMTICILIAYEYIMNGTNIIIEKKINDKL* |
| Ga0078893_103884313 | 3300005837 | Marine Surface Water | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKINDIS* |
| Ga0075474_100835833 | 3300006025 | Aqueous | DFIDFHVLFMTICILIAYEYIMNGTNIIIEKKLNDIS* |
| Ga0075478_101895302 | 3300006026 | Aqueous | MKLDDFIDFHVLFMTICILIAYEYIMNGTNIIIEKKLNDIS* |
| Ga0075445_100051075 | 3300006193 | Marine | MTIDDFIDFHALFLTASAVIAYKYITKENNVIFERKKI* |
| Ga0075445_101064542 | 3300006193 | Marine | MNFKIDDYIDFHILFMTISIVIAYKYITDESNIIVEKKN* |
| Ga0075445_101924551 | 3300006193 | Marine | MNLKSFKIENYIDFDVLFMTICILIFLEYIMNHSDIIIEKKYTDK* |
| Ga0068470_11301721 | 3300006308 | Marine | MKIEDIIDYHTLFMTMCIVIAYKYITIEENIILEKKIQ* |
| Ga0068471_15717183 | 3300006310 | Marine | MKIEDIIDYHTLFMTMCIVIAYKYITIEENIILEKKLQ* |
| Ga0068500_13431052 | 3300006332 | Marine | MNIKIENYIDFHVLFMTICILIAYEYIMNNSNIIVEKKIKDI* |
| Ga0075444_102819952 | 3300006947 | Marine | MNFKIEDYIDFHVLFMTISITIAYKYITNESNIIVEKKDFRTSK* |
| Ga0075460_101336242 | 3300007234 | Aqueous | MKFQIDDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKLNDKL* |
| Ga0066367_13194982 | 3300007291 | Marine | MDIEDYIDFKVLFTTMCIVIAYKYITLEEDIIIERKLS* |
| Ga0114996_101937602 | 3300009173 | Marine | MTFKDFQIDDYIDFDTLFMTICILIFYEYIMNHSDIIIEKKYTDK* |
| Ga0114996_103562643 | 3300009173 | Marine | MNLKDFKLEDYIDFHVLFMTMCILVLYHYIMNDSNIIIEKKKP* |
| Ga0118722_13162062 | 3300009376 | Marine | MDIEDYIDFKVIFTTMCIVIAYKYITHDENIIIEKKI* |
| Ga0114993_112366291 | 3300009409 | Marine | MNFKIEDYIDFHVLFMTISIIIAYKYITDESNIIV |
| Ga0114994_100349054 | 3300009420 | Marine | MNLKSFKIENYIDFDTLFMTICILIFYEYIMNHSDIIIEKKYTDK* |
| Ga0114994_101309824 | 3300009420 | Marine | MNFEIEDYIDFHVLFVTMCIVIAYRYITDEQDIIVERKID* |
| Ga0114994_102274623 | 3300009420 | Marine | MTFKIENYIDFHVLFMTICILIAYEYIMNGSNIIIEKKIKDIS* |
| Ga0114994_102807982 | 3300009420 | Marine | MKFEIENYIDFHVLFSTICIVIAYKYITNEQNIIIEKKYNY* |
| Ga0114994_105473382 | 3300009420 | Marine | KIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKK* |
| Ga0115000_100391271 | 3300009705 | Marine | MNFKIEDYIDFHVLFMTISIIIAYKYITDESNIIVEKKGIK* |
| Ga0115000_100452887 | 3300009705 | Marine | MNFKIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKK* |
| Ga0115002_108396233 | 3300009706 | Marine | MNLKDFKLEDYIDFHVLFMTMCILVLYHYVMNDSNIIVEKKINDK* |
| Ga0114999_100578733 | 3300009786 | Marine | MNFKDFKIDDLIDFHVLFMTMCILIAYHYIMNDSNIIVEKKINDK* |
| Ga0114999_100731811 | 3300009786 | Marine | KIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKKN* |
| Ga0136655_10034014 | 3300010316 | Freshwater To Marine Saline Gradient | MKLEDFIDFHVLFMTICVLIAYEYIMNGTNIIVEKKINDK* |
| Ga0129324_101002452 | 3300010368 | Freshwater To Marine Saline Gradient | MKFQIEDFIDFHVLFMTICVLIGYEYIMNGTNIIVEKKINDKL* |
| Ga0133547_101287002 | 3300010883 | Marine | MNFKIEEYIDFHVLFMTISIIIAYKYITDESNIIVEKRNINK* |
| Ga0133547_102495852 | 3300010883 | Marine | MNFKIEDYIDFHVLFMTISLIIAYKYITDGNNIIVEKKN* |
| Ga0133547_105050851 | 3300010883 | Marine | MNSKIEDYIDFHVLFMTISIIIAYKYITEESNIIIEKKEIK* |
| Ga0133547_106057775 | 3300010883 | Marine | MNFKVEDYIDFHVLFMTITIIIAYKYITDEVNIIIETQT |
| Ga0160423_102288803 | 3300012920 | Surface Seawater | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIIEKKINDIS* |
| Ga0160423_105293882 | 3300012920 | Surface Seawater | MKFQIDDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKLNDK* |
| Ga0163109_107043692 | 3300012936 | Surface Seawater | MKFQIDDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKLNDK* |
| Ga0181413_12127181 | 3300017765 | Seawater | MKLEDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKLKDK |
| Ga0181565_106372413 | 3300017818 | Salt Marsh | MKFQIEDFIDFHVLFMTICILIAYEYIMNSSNIIVE |
| Ga0181552_106086882 | 3300017824 | Salt Marsh | MKLDDFIDFHVLFMTICILIAYEYIMNGTNIIIEKKLNDIS |
| Ga0181607_104795231 | 3300017950 | Salt Marsh | MKLDDFIDFHVLFMTICILIAYEYIMNGSNIIIEKKIKDIS |
| Ga0181590_102737383 | 3300017967 | Salt Marsh | MKLDDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKINDKL |
| Ga0181606_103609941 | 3300018048 | Salt Marsh | YIDFHVLFMTICILIGYEYIMNNSNIIIEKKIKDI |
| Ga0181563_105706511 | 3300018420 | Salt Marsh | MKLDDFIDFHVLFMAICILIAYEYIMNGSNIIVEKKLNDIS |
| Ga0181595_101176372 | 3300020053 | Salt Marsh | MNIKIENYIDFHVLFMTICILIGYEYIMNNSNIIIEKKIKDI |
| Ga0181603_103023001 | 3300020174 | Salt Marsh | MNIKIENYIDFHVLFMTICILIGYEYIMNNSNIIIEK |
| Ga0211658_11180622 | 3300020274 | Marine | NMRFQIEDFIDFHVLFMTICILIAYEYIMNESNIIVEKKIK |
| Ga0211497_100753332 | 3300020394 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKLKDK |
| Ga0211583_101277943 | 3300020397 | Marine | MRFQIEDFIDFHVLFMTICILIAYEYIMNESNIIVEKKIKG |
| Ga0211636_101374603 | 3300020400 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKIKDKL |
| Ga0211532_103986311 | 3300020403 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKINDKL |
| Ga0211659_100167093 | 3300020404 | Marine | MRFQIEDFIDFHVLFMTICILIAYEYIMNESNIIVEKKIK |
| Ga0211496_100016078 | 3300020405 | Marine | MKFQIDDFINFHVLFMTICILIAYEYIMNGSNIIIEKKIKDK |
| Ga0211699_102306882 | 3300020410 | Marine | MKIENIIDYHTLFMTMCIVIAYKYITIEENIILEKKI |
| Ga0211528_102112892 | 3300020417 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKNK |
| Ga0211576_1000150813 | 3300020438 | Marine | MKLEDFIDFHILFMTICILIAYEYIMGGTNIIIEKKIKDK |
| Ga0211576_101002863 | 3300020438 | Marine | MKLDDFIDFHVLFTTICIVIAYQYITNEMNIIVEKKISL |
| Ga0211518_100561675 | 3300020440 | Marine | MKFQIDDFIDFHVLFMTICILIAYEYIMNSSNIIIEKKINDKL |
| Ga0211574_100076748 | 3300020446 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNSSNIIVEKNLNDIS |
| Ga0211574_100534143 | 3300020446 | Marine | MKFEIENYIDFHVLFTTISIVIAYKYITHEENIIIEKKIG |
| Ga0211691_101549611 | 3300020447 | Marine | MKINNIIDYHTLFMTMCIVIAYKYITIEENIILEKKYK |
| Ga0211638_101028902 | 3300020448 | Marine | MKLEDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKINDK |
| Ga0211486_100234694 | 3300020460 | Marine | MDIEDYIDFKVLFTTMCIVIAYKYITLEENIIIERKLT |
| Ga0211577_100241467 | 3300020469 | Marine | MKFEIENYIDFHILFTTICIVIAYKYITNEQNIIIEKKFN |
| Ga0211585_100317095 | 3300020477 | Marine | MKIEDIIDYHTLFMTMCIVIAYKYITIEENIILEKKI |
| Ga0206682_100336735 | 3300021185 | Seawater | MKLEDFIDFHVLFMTICILIAYEYIMGQSNIIVEKKLKDK |
| Ga0222719_104231762 | 3300021964 | Estuarine Water | ILLNINMKLEDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKINDKL |
| Ga0222719_108283271 | 3300021964 | Estuarine Water | MKLEDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKIND |
| (restricted) Ga0233426_100488784 | 3300022920 | Seawater | MKFQIDDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKLNDK |
| (restricted) Ga0233432_1000939412 | 3300023109 | Seawater | MTFKIDDYIDFHVLFMTICILIAYEYIMNGSNIIIKKNII |
| (restricted) Ga0233432_100138333 | 3300023109 | Seawater | MKLEDFIDFHVLFMTICILIAYEYIMNGSNIIVEKKLKDK |
| (restricted) Ga0233432_102646362 | 3300023109 | Seawater | MKLEDFIDFHVLFMTICILIAYEYIMNETNIIIEKKINDK |
| (restricted) Ga0233432_103592303 | 3300023109 | Seawater | MKLDDFIDFHVLFMTICILIAYEYIMNGTNIIVEKKLNDK |
| Ga0208542_11128782 | 3300025818 | Aqueous | MKFQIDDFIDFHVLFMTICILIAYEYIMNSSNIIVEKKLNDKL |
| Ga0208547_11382222 | 3300025828 | Aqueous | FQIDDFIDFHVFFMTICILIAYEYIMNGTNIIVEKKINDK |
| Ga0209630_103348012 | 3300025892 | Pelagic Marine | MKLEDFIDFHVLFMTICVLIGYEYIMNDTNIIIEKKINDKL |
| Ga0209335_101631833 | 3300025894 | Pelagic Marine | MKLQIEDFIDFHVLFMTICIIIAYEYIMGQSNIIVEKKLKDK |
| Ga0209383_11742182 | 3300027672 | Marine | MNFKIDDYIDFHILFMTISIVIAYKYITDESNIIVEKKN |
| Ga0209383_11867012 | 3300027672 | Marine | MTIDDFIDFHALFLTASAVIAYKYITKENNIIFERKKI |
| Ga0209710_10349843 | 3300027687 | Marine | MNLKSFKIENYIDFDTLFMTICILIFYEYIMNHSDIIIEKKYTDK |
| Ga0209709_101395742 | 3300027779 | Marine | MTFKIENYIDFHVLFMTICILIAYEYIMNGSNIIIEKKIKDIS |
| Ga0209090_100632391 | 3300027813 | Marine | MNFKDFKIDDYIDFDTLFMTICILIFYEYIMNNSNI |
| Ga0209090_104545832 | 3300027813 | Marine | MNFKIEDYIDFHVLFMTISLIIAYKYITDGNNIIVEKKN |
| Ga0209090_105651682 | 3300027813 | Marine | MNFKIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKKN |
| Ga0209089_100326454 | 3300027838 | Marine | MTFKDFQIDDYIDFDTLFMTICILIFYEYIMNHSDIIIEKKYTDK |
| Ga0209402_100539764 | 3300027847 | Marine | MKFEIENYIDFHVLFSTICIVIAYKYITNEQNIIIEKNLMIENKFN |
| Ga0228646_11121841 | 3300028280 | Seawater | MKLEDFIDFHVLFMTICILIAYEYIMNSSNIIIEKKLNDKL |
| Ga0308025_10866513 | 3300031143 | Marine | YKMNFKIEDYIDFHVLFMTISIVIAYKYITGESNIIIEKK |
| Ga0308025_11061011 | 3300031143 | Marine | MNFKIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKKEINY |
| Ga0308025_11273783 | 3300031143 | Marine | MNLKSFKIENYIDFDVLFMTICILIFLEYIMNHSDIIIEKKYTDK |
| Ga0308010_10609082 | 3300031510 | Marine | MNFKIEDYIDFHVLFMTISIVIAYKYITDESNIIVEKKEINYDKKNI |
| Ga0307488_100039297 | 3300031519 | Sackhole Brine | MNFKDFKIDDYIDFDTLFMTICILIFYEYIMNNSDIIIEKKYTDK |
| Ga0307488_101159993 | 3300031519 | Sackhole Brine | MNFKDFKIDDYIDFDTLFMTICILIFYEYIMNNSNIIIEKKSTDK |
| Ga0307488_102940972 | 3300031519 | Sackhole Brine | DDYIDFDTLFMTICILIFYEYIMNNSNIIIEKKSTDK |
| Ga0307488_104221133 | 3300031519 | Sackhole Brine | MNFKDFNIDDYIDFDTLFMTICVLIFYEYIMNNSDIIIEKKYTDK |
| Ga0307488_104830011 | 3300031519 | Sackhole Brine | MNFKDLNIDDYIDFDTLFMTICVLIFYEYIMNNSDIIIEKKYTDK |
| Ga0307488_108501351 | 3300031519 | Sackhole Brine | MNFKDFNIDDYIDFDTLFMTVCILIFYEYIMNNSNIIIEKKYKDK |
| Ga0315316_104831752 | 3300032011 | Seawater | MDIEDYIDLKVLFTTMCIVIAYKYITLEEDIIIEKKLS |
| Ga0315316_114703211 | 3300032011 | Seawater | MKIENIIDYHTLFMTMCIVIAYKYITIEENIILEQKI |
| Ga0315315_100655493 | 3300032073 | Seawater | MNIKIENYIDFHVLFMTICILIAYEYIMNNSNIIVEKKIKDI |
| Ga0310345_100379908 | 3300032278 | Seawater | MDIEDYIDFKVIFTTMCIVIAYKYITLEEDIIIEKKLS |
| Ga0310345_103126501 | 3300032278 | Seawater | MDIEDYIDFKVLFTTMCIVIAYKYITLEEDIIIERKLS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |