Basic Information | |
---|---|
Family ID | F092166 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 39 residues |
Representative Sequence | FYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 90.65 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.897 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.411 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.430 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.991 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF03279 | Lip_A_acyltrans | 78.50 |
PF04613 | LpxD | 2.80 |
PF00581 | Rhodanese | 1.87 |
PF07883 | Cupin_2 | 0.93 |
PF02449 | Glyco_hydro_42 | 0.93 |
PF00202 | Aminotran_3 | 0.93 |
PF05635 | 23S_rRNA_IVP | 0.93 |
PF13442 | Cytochrome_CBB3 | 0.93 |
PF14602 | Hexapep_2 | 0.93 |
PF12867 | DinB_2 | 0.93 |
PF05299 | Peptidase_M61 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 78.50 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 78.50 |
COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.93 |
COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.93 |
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.90 % |
Unclassified | root | N/A | 27.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002558|JGI25385J37094_10054655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1325 | Open in IMG/M |
3300004152|Ga0062386_100377145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1139 | Open in IMG/M |
3300005435|Ga0070714_100200899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1823 | Open in IMG/M |
3300005543|Ga0070672_100503034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1048 | Open in IMG/M |
3300005602|Ga0070762_10522288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 780 | Open in IMG/M |
3300005888|Ga0075289_1042706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 698 | Open in IMG/M |
3300005921|Ga0070766_10453233 | Not Available | 847 | Open in IMG/M |
3300006059|Ga0075017_100247707 | Not Available | 1302 | Open in IMG/M |
3300006059|Ga0075017_100455149 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300006162|Ga0075030_100690608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166 | 808 | Open in IMG/M |
3300006354|Ga0075021_10821257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
3300009012|Ga0066710_101997410 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300009038|Ga0099829_10441459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
3300009623|Ga0116133_1175199 | Not Available | 569 | Open in IMG/M |
3300009638|Ga0116113_1018697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1515 | Open in IMG/M |
3300009638|Ga0116113_1203107 | Not Available | 513 | Open in IMG/M |
3300009639|Ga0116122_1140965 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300009660|Ga0105854_1101596 | Not Available | 898 | Open in IMG/M |
3300009672|Ga0116215_1453500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300010320|Ga0134109_10412641 | Not Available | 542 | Open in IMG/M |
3300010360|Ga0126372_10033073 | Not Available | 3280 | Open in IMG/M |
3300010366|Ga0126379_12972699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300010376|Ga0126381_101238665 | Not Available | 1078 | Open in IMG/M |
3300010376|Ga0126381_103885526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 583 | Open in IMG/M |
3300010379|Ga0136449_101721089 | Not Available | 943 | Open in IMG/M |
3300010379|Ga0136449_102796908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300010396|Ga0134126_10064766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4546 | Open in IMG/M |
3300011119|Ga0105246_10289647 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300011270|Ga0137391_10899691 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300012210|Ga0137378_11643485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300012363|Ga0137390_11650391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300012917|Ga0137395_10509561 | Not Available | 867 | Open in IMG/M |
3300012923|Ga0137359_11490736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300012925|Ga0137419_10750089 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012929|Ga0137404_10097081 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300012929|Ga0137404_11437983 | Not Available | 637 | Open in IMG/M |
3300012989|Ga0164305_11617011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300013296|Ga0157374_10564872 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300013297|Ga0157378_10628528 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300014151|Ga0181539_1068859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1579 | Open in IMG/M |
3300014155|Ga0181524_10263511 | Not Available | 803 | Open in IMG/M |
3300014158|Ga0181521_10284669 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300014165|Ga0181523_10398185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300014167|Ga0181528_10346476 | Not Available | 806 | Open in IMG/M |
3300014200|Ga0181526_10296483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1030 | Open in IMG/M |
3300015372|Ga0132256_100231305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1909 | Open in IMG/M |
3300017929|Ga0187849_1352374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300017930|Ga0187825_10169029 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300017935|Ga0187848_10479225 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300017943|Ga0187819_10428940 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300017973|Ga0187780_11339053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 527 | Open in IMG/M |
3300017995|Ga0187816_10415958 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018012|Ga0187810_10205321 | Not Available | 802 | Open in IMG/M |
3300018057|Ga0187858_10710284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 599 | Open in IMG/M |
3300018090|Ga0187770_11162716 | Not Available | 623 | Open in IMG/M |
3300019284|Ga0187797_1854242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300020579|Ga0210407_10654876 | Not Available | 816 | Open in IMG/M |
3300020582|Ga0210395_11288873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300021171|Ga0210405_10372989 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300021406|Ga0210386_10014780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6094 | Open in IMG/M |
3300021420|Ga0210394_10915719 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300024227|Ga0228598_1051290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300024271|Ga0224564_1116167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300025812|Ga0208457_1095457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300025909|Ga0207705_10071709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2511 | Open in IMG/M |
3300025922|Ga0207646_10300679 | Not Available | 1450 | Open in IMG/M |
3300025923|Ga0207681_11389681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300025944|Ga0207661_10341592 | Not Available | 1349 | Open in IMG/M |
3300025945|Ga0207679_11047733 | Not Available | 748 | Open in IMG/M |
3300025986|Ga0207658_10697765 | Not Available | 917 | Open in IMG/M |
3300025986|Ga0207658_12124090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300026088|Ga0207641_10636337 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300026142|Ga0207698_11760250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300026294|Ga0209839_10179888 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300026514|Ga0257168_1096856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300026538|Ga0209056_10029111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5240 | Open in IMG/M |
3300027432|Ga0209421_1058911 | Not Available | 769 | Open in IMG/M |
3300027497|Ga0208199_1027946 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300027610|Ga0209528_1130348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300027635|Ga0209625_1072271 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300027729|Ga0209248_10067903 | Not Available | 1084 | Open in IMG/M |
3300027803|Ga0209910_10052738 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300027825|Ga0209039_10301758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300027894|Ga0209068_10636025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300027898|Ga0209067_10261845 | Not Available | 943 | Open in IMG/M |
3300028665|Ga0302160_10021338 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300028678|Ga0302165_10031843 | Not Available | 1413 | Open in IMG/M |
3300028747|Ga0302219_10268673 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300028788|Ga0302189_10411088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300028873|Ga0302197_10411662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300029918|Ga0302143_1186542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300029954|Ga0311331_10082678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4212 | Open in IMG/M |
3300029954|Ga0311331_10311758 | Not Available | 1666 | Open in IMG/M |
3300030019|Ga0311348_10388070 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300030058|Ga0302179_10034191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2354 | Open in IMG/M |
3300030494|Ga0310037_10263894 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300031234|Ga0302325_12114608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300031247|Ga0265340_10224669 | Not Available | 841 | Open in IMG/M |
3300031249|Ga0265339_10052750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2214 | Open in IMG/M |
3300031708|Ga0310686_109533643 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300031718|Ga0307474_10642148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 837 | Open in IMG/M |
3300031820|Ga0307473_10213248 | Not Available | 1156 | Open in IMG/M |
3300032174|Ga0307470_10438471 | Not Available | 936 | Open in IMG/M |
3300032828|Ga0335080_10001830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21188 | Open in IMG/M |
3300032892|Ga0335081_11114103 | Not Available | 908 | Open in IMG/M |
3300033433|Ga0326726_12118900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300034090|Ga0326723_0104568 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.41% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.61% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.67% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.80% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.80% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.93% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25385J37094_100546552 | 3300002558 | Grasslands Soil | IKQDKDSTREFYNRMVPFKTALTGTIDAPANAYPLLSTLAKWAKTASEK* |
Ga0062386_1003771452 | 3300004152 | Bog Forest Soil | EFYGRMVPFKTSLQGEIEAPKAAYSFLSSLAKWAQEAAK* |
Ga0070714_1002008993 | 3300005435 | Agricultural Soil | TSTREFYGRMVPFRTSLTGEIQSPEGGRPLLVSLSKFATEAAK* |
Ga0070672_1005030341 | 3300005543 | Miscanthus Rhizosphere | STREFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK* |
Ga0070762_105222882 | 3300005602 | Soil | RDFYGRMVPFKTSLKGEVEAPKASYPFLSTLAKWAQVAAK* |
Ga0075289_10427063 | 3300005888 | Rice Paddy Soil | SSTREFYGRMVPFKTALKAQIAAPDEAFPFLNALAKWAVVAAQG* |
Ga0070766_104532332 | 3300005921 | Soil | GRMVPFKTSLKGTIDPPANAFPFLNTLAKWAKTAAASK* |
Ga0075017_1002477072 | 3300006059 | Watersheds | GRMVPFKTSLKGEVEAPKSAYPFLSPLAKWAQVASK* |
Ga0075017_1004551493 | 3300006059 | Watersheds | STREFYGRMVPFKTALKGDIEAPKAAYPFLSTLAKWAQQASK* |
Ga0075030_1006906082 | 3300006162 | Watersheds | KDSTREFYGRMVPFRTALKGEIETPKAAYPFLSTLAKWAQQASK* |
Ga0075021_108212572 | 3300006354 | Watersheds | FYNRMVPFKTSLTGTIEPPPNAYPFLSTLAKWAKTAATK* |
Ga0066710_1019974101 | 3300009012 | Grasslands Soil | TREFYNRMVPFKTSLTGTIDAPQGAYPFLNVLAKWAKTAAAK |
Ga0099829_104414594 | 3300009038 | Vadose Zone Soil | REFYGRMVPFKTSLTGEIETPKAAYPFLSTLAKWAQQASK* |
Ga0116133_11751991 | 3300009623 | Peatland | YGRMVPFKTSLTGEIDAPKGAYPFLSTLAKWAQIASR* |
Ga0116113_10186972 | 3300009638 | Peatland | RMVPFKTSLKGEVDAPKDAYPFLSSLAKWAVEAAK* |
Ga0116113_12031072 | 3300009638 | Peatland | DSTREFYGRMVPFKTSLTGEIDAPKGAYPFLSTLAKWAQIASR* |
Ga0116122_11409651 | 3300009639 | Peatland | MVPFKTSLKGDIEAPQAAYPFLSTLAKWAQEAAK* |
Ga0105854_11015961 | 3300009660 | Permafrost Soil | MVPFKTSLKGTIPPPPDANVFLTTLAKWAQVAAK* |
Ga0116215_14535001 | 3300009672 | Peatlands Soil | NGAVIKQDEASTREFYGSMVPFKTSLKGEIDPPKPSLPFLDTLAKWAKNAG* |
Ga0134109_104126411 | 3300010320 | Grasslands Soil | VPFKTALTGTIDAPANAYPLLSTLARWAKTASEK* |
Ga0126372_100330734 | 3300010360 | Tropical Forest Soil | MVPFKTSLQGNIEAPKNAYPFLNTLAKWAQEAAKK* |
Ga0126379_129726991 | 3300010366 | Tropical Forest Soil | MVPFKTSLTGEIEPPQGAYPFLSVLAKWAKVAADK* |
Ga0126381_1012386651 | 3300010376 | Tropical Forest Soil | STREFYGRMVPFKTSLSGEIEAPGTAYPFLSTLAKWAKTAANK* |
Ga0126381_1038855261 | 3300010376 | Tropical Forest Soil | STREFYGRMVPFKTSLSGEIEAPGTAYPFLSTLAKWAKTAADK* |
Ga0136449_1017210891 | 3300010379 | Peatlands Soil | ESTREFYGRMVPFPTSLKGEIEAPKDAYPFLSTLAKWALQAAK* |
Ga0136449_1027969082 | 3300010379 | Peatlands Soil | EFYGRMVPFKTSLKGEIDAPKDAYPFLSTLAKWALQAAK* |
Ga0134126_100647667 | 3300010396 | Terrestrial Soil | FYGRMVPFRTSLKGTIDAPPNAYPFLNTLAKWAKTAATK* |
Ga0105246_102896471 | 3300011119 | Miscanthus Rhizosphere | KDSTREFYGRLVPFKTSLTGSIDAPANAYPFLNTLAKWAKTAATK* |
Ga0137391_108996912 | 3300011270 | Vadose Zone Soil | RMVPFKTSLTGEVDPPAGANTFLTALAKWAQEASK* |
Ga0137378_116434852 | 3300012210 | Vadose Zone Soil | YGRMVPFKTSLTGTIDAPAGAYPFLSVLAKWAKTASEK* |
Ga0137390_116503912 | 3300012363 | Vadose Zone Soil | FYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK* |
Ga0137395_105095612 | 3300012917 | Vadose Zone Soil | IVPFKTSLTGTIGPPSNAYPFLNTLAKWAKTAAAAK* |
Ga0137359_114907362 | 3300012923 | Vadose Zone Soil | RDFYGRMVPFKTSLEGNIEAPQAAFPFLNTLAKWAKAAEGK* |
Ga0137419_107500892 | 3300012925 | Vadose Zone Soil | FYGRMVPFKTSLTGTIDPPPNAYPLLNTLAKWAKTAATAK* |
Ga0137404_100970814 | 3300012929 | Vadose Zone Soil | YGRMVPFRTSLTGKVEAPQGAYPFLNTLAKWAKKAADK* |
Ga0137404_114379832 | 3300012929 | Vadose Zone Soil | MVPFKTSLQGTIDAPDTAYPFLSTLAKWAKAAASK* |
Ga0164305_116170112 | 3300012989 | Soil | KDATREFYERMVPFKTSLTGNVEAPAAANSFLTTLAHWAQSAAKK* |
Ga0157374_105648721 | 3300013296 | Miscanthus Rhizosphere | FYGRMVPFKTSLSGTIDAPENARPLLETIAKWAKTSADK* |
Ga0157378_106285282 | 3300013297 | Miscanthus Rhizosphere | RMVPFKTSLQGTIPAPDAAYPFLSTLAKWAKEAAKK* |
Ga0181539_10688593 | 3300014151 | Bog | FYGHMVPSKTALKGEIEAPKAAYPFLNTLAKWAQQAAK* |
Ga0181524_102635112 | 3300014155 | Bog | YGHMVPSKTALKGEIEAPKAAYPFLNTLAKWAQQAAK* |
Ga0181521_102846691 | 3300014158 | Bog | TREFYGRMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQAAK* |
Ga0181523_103981851 | 3300014165 | Bog | GRMVPFKTSLVGEIDPPAGANAFLSSLAKWAQEAAK* |
Ga0181528_103464761 | 3300014167 | Bog | RDFYGRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK* |
Ga0181526_102964831 | 3300014200 | Bog | DFYGRMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQASK* |
Ga0132256_1002313051 | 3300015372 | Arabidopsis Rhizosphere | ARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK* |
Ga0187849_13523741 | 3300017929 | Peatland | GSTREFYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQAAK |
Ga0187825_101690292 | 3300017930 | Freshwater Sediment | YGRMVPFKTSLTGEIDAPAGANAFLTTLAKWAQEASK |
Ga0187848_104792252 | 3300017935 | Peatland | FYGRMVPFKTSLKVEVEAPKAAYPFLSTLAKWAQQASK |
Ga0187819_104289402 | 3300017943 | Freshwater Sediment | STREFYGSMVPFKTSLKGEIDPPKPSMPFLDTLAKWAKNAG |
Ga0187780_113390531 | 3300017973 | Tropical Peatland | RDFYGRMVPFKTSLKGDIEAPKDAYPFLNTRAKWAQIASK |
Ga0187816_104159582 | 3300017995 | Freshwater Sediment | DFYGRMVPFKTSLKGEIEAPKSAYPFLSTLAKWAQAASK |
Ga0187810_102053211 | 3300018012 | Freshwater Sediment | STRDFYGRMVPFKTSLTGEIDAPKSAYPFLSTLAKWAQQASK |
Ga0187858_107102842 | 3300018057 | Peatland | FYGRMVPFKTSLKGDIEAPKDAYPFLSTLAKWAQEAAK |
Ga0187770_111627161 | 3300018090 | Tropical Peatland | KNATRDFYGHMVLSKTSLQGQIEAPKEAYPFLETLAKWAKAAAGK |
Ga0187797_18542421 | 3300019284 | Peatland | FYGRMVPFKTSLKGDIEAPNSAYPFLSSLAKWAQIAAK |
Ga0210407_106548761 | 3300020579 | Soil | EFFGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK |
Ga0210395_112888731 | 3300020582 | Soil | RMVPFRTSLIGEIDPPAGANAFLTSLAKWAQDAAK |
Ga0210405_103729892 | 3300021171 | Soil | YGRMVPFRTSLVGEIEPPPGANAFLTALAQWAQEAAK |
Ga0210386_100147807 | 3300021406 | Soil | MVPFKTSLTGEVEAPAGAFPFLNSLAKWAKSASSK |
Ga0210394_109157191 | 3300021420 | Soil | QDKDSTREFYGHMVPFDTALHGTIEAPKSAFPFLDTLAKWAKAAG |
Ga0228598_10512902 | 3300024227 | Rhizosphere | RMVPFRTSLTGEIDPPAGANAFLRTLAQWAQDAAK |
Ga0224564_11161672 | 3300024271 | Soil | DFYGRMVPFKTSLKGEVDAPKDAYPFLSSLAKWAQEAAK |
Ga0208457_10954572 | 3300025812 | Peatland | DKESTYEFYGRMVPFKTSLRGEIEAPKAAYPFLSTLAKWAQQAAK |
Ga0207705_100717091 | 3300025909 | Corn Rhizosphere | REFYGRMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK |
Ga0207646_103006793 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPFKTSLEGSIDAPQTAYPFLNTLAKWGKAAEKK |
Ga0207681_113896811 | 3300025923 | Switchgrass Rhizosphere | TREFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK |
Ga0207661_103415921 | 3300025944 | Corn Rhizosphere | REFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK |
Ga0207679_110477331 | 3300025945 | Corn Rhizosphere | MVPFKTSLTGSIDAPANAYPFLNTLAKWAKTAATK |
Ga0207658_106977652 | 3300025986 | Switchgrass Rhizosphere | GRMVPFKTSLQGTIDPPDTAYPFLSTLAKWAKEAASK |
Ga0207658_121240901 | 3300025986 | Switchgrass Rhizosphere | RMVPFKTSLTGTIEAPKNAYPFLNTLAKWAKNAASK |
Ga0207641_106363372 | 3300026088 | Switchgrass Rhizosphere | MVPFRTSLKGTIDAPPNAYPFLNTLAKWAKTAATK |
Ga0207698_117602502 | 3300026142 | Corn Rhizosphere | GRMVPFRTSLQGTVDAPAGAYPFLQTLSKWAKVAAK |
Ga0209839_101798882 | 3300026294 | Soil | GHNVTFRNSLKGNIEAPKASYPFLDTLAKWAKAAS |
Ga0257168_10968562 | 3300026514 | Soil | TREFFGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK |
Ga0209056_100291116 | 3300026538 | Soil | YGRMVPFRTALTGEIEPPAAANPFLSTLAKWAQEAAK |
Ga0209421_10589111 | 3300027432 | Forest Soil | STREFYGRMVPFRTSLQETIEAPKAAYPFLSTLAKWAKTASQ |
Ga0208199_10279462 | 3300027497 | Peatlands Soil | REFYGRMVPFPTSLKGEIEAPKDAYPFLSTLAKWALQAAK |
Ga0209528_11303482 | 3300027610 | Forest Soil | REFYGRMVPFKTALTGEIDPPAGSNVFLMGLAQWAQAAAK |
Ga0209625_10722711 | 3300027635 | Forest Soil | YGRMVPFKTALTGEIDPPAGSNVFLMGLAQWAQAAAK |
Ga0209248_100679031 | 3300027729 | Bog Forest Soil | YGRMVPFKTSLKGEVDAPKDAYPFLSSLAKWAQEAAK |
Ga0209910_100527381 | 3300027803 | Thawing Permafrost | GRMVPFKTALKGEIDAPKDAYPFLSTLAKWAQQAAK |
Ga0209039_103017582 | 3300027825 | Bog Forest Soil | GRMVPFKTSLKGDIETPKAAYPFLSTLAKWAQEAAK |
Ga0209068_106360252 | 3300027894 | Watersheds | SQDKDATRQFYNRMVPFKTSLTGTIEPPPNAYPFLSTLAKWAKTAATK |
Ga0209067_102618452 | 3300027898 | Watersheds | KDSTREFYGRMVPFKTALKGDIEAPKAAYPFLSTLAKWAQQAAK |
Ga0302160_100213381 | 3300028665 | Fen | RMVPFKTSLKGEVEAPKMAYPFLSSLAKWAQQAAK |
Ga0302165_100318431 | 3300028678 | Fen | RDFYSRMVPFRTSLQGNIDAPQAAYPFLSTLAKWAKSAESK |
Ga0302219_102686731 | 3300028747 | Palsa | FYGHMVPFKTSLKGEIEAPQAAYPFLSTLAKWAQQASK |
Ga0302189_104110882 | 3300028788 | Bog | FYGRMVPFKTSLTGEIEAPPVANSFLTTLAKWAQEAAK |
Ga0302197_104116621 | 3300028873 | Bog | GRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK |
Ga0302143_11865421 | 3300029918 | Bog | YGRMVPFKTSLTGEIEAPPVANSFLTTLAKWAQEAAK |
Ga0311331_100826786 | 3300029954 | Bog | STRDFYGRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK |
Ga0311331_103117583 | 3300029954 | Bog | REFYGRMVPFRTSLVGEIDAPAGANAFLTSLAKWAQEAAK |
Ga0311348_103880701 | 3300030019 | Fen | FYGRMVPFKTSLKGEVEAPKMAYPFLSSLAKWAQQAAK |
Ga0302179_100341911 | 3300030058 | Palsa | KQDKDSTREFYGHMVPFKTSLKGEIEAPQAAYPFLSTLAKWAQQASK |
Ga0310037_102638942 | 3300030494 | Peatlands Soil | FYGRMVPFNTSLKGTIEAPKTAYPFLDTLAKWAKASS |
Ga0302325_121146081 | 3300031234 | Palsa | EFYGHMVPFDTSLHSTIDTPKTAYPFLDTLAKWAKAVS |
Ga0265340_102246692 | 3300031247 | Rhizosphere | YEFYGHLVPFKTALKGQIEAPKAAYPFLGTLAKFAQHAAREKE |
Ga0265339_100527501 | 3300031249 | Rhizosphere | KDSTRDFYGHMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQAAK |
Ga0310686_1095336433 | 3300031708 | Soil | REFYGRMVPFKTSLKGEVDAPKTAYPFLSTLAKWAQVASK |
Ga0307474_106421482 | 3300031718 | Hardwood Forest Soil | KQDKDSTREFYGHMVPFKTSLKGEIEAPQASYPFLSTLAKWAQQAAK |
Ga0307473_102132481 | 3300031820 | Hardwood Forest Soil | GRMVPFKTSLEGNIEAPQAAYPFLNTLAKWAKAAEGK |
Ga0307470_104384712 | 3300032174 | Hardwood Forest Soil | GRMVPFRTSLTGEIEAPAGAHEFLSSLAQWAQEAAK |
Ga0335080_100018301 | 3300032828 | Soil | FYGRMVPFKTALTGTIDAPKEAYPLLDTLAKWAKAAAAK |
Ga0335081_111141032 | 3300032892 | Soil | REFYGRMVPFKTSLQGDIEAPKSAYPFLSSLAKWAKAAEK |
Ga0326726_121189001 | 3300033433 | Peat Soil | RMVPFKTSLTGTIDAPANAYPFLSTLAKWAKTAAEK |
Ga0326723_0104568_1099_1206 | 3300034090 | Peat Soil | MVPFKTSLTGTIDAPANAYPFLNTLAKWAKTAATK |
⦗Top⦘ |