Basic Information | |
---|---|
Family ID | F092138 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 44 residues |
Representative Sequence | MGNRRLDAKAFGLIAALLVLTGAVVLWVRRRNWTDHDVSDPGVTL |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 49.53 % |
% of genes near scaffold ends (potentially truncated) | 40.19 % |
% of genes from short scaffolds (< 2000 bps) | 83.18 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.421 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.103 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.121 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF12802 | MarR_2 | 7.48 |
PF03640 | Lipoprotein_15 | 2.80 |
PF01120 | Alpha_L_fucos | 2.80 |
PF01266 | DAO | 2.80 |
PF12680 | SnoaL_2 | 1.87 |
PF00571 | CBS | 1.87 |
PF01565 | FAD_binding_4 | 1.87 |
PF08031 | BBE | 1.87 |
PF01152 | Bac_globin | 0.93 |
PF00122 | E1-E2_ATPase | 0.93 |
PF09903 | DUF2130 | 0.93 |
PF13474 | SnoaL_3 | 0.93 |
PF13412 | HTH_24 | 0.93 |
PF01451 | LMWPc | 0.93 |
PF08922 | DUF1905 | 0.93 |
PF13701 | DDE_Tnp_1_4 | 0.93 |
PF13302 | Acetyltransf_3 | 0.93 |
PF01609 | DDE_Tnp_1 | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
PF01595 | CNNM | 0.93 |
PF03098 | An_peroxidase | 0.93 |
PF13551 | HTH_29 | 0.93 |
PF02517 | Rce1-like | 0.93 |
PF03633 | Glyco_hydro_65C | 0.93 |
PF00079 | Serpin | 0.93 |
PF13649 | Methyltransf_25 | 0.93 |
PF11716 | MDMPI_N | 0.93 |
PF00069 | Pkinase | 0.93 |
PF09924 | LPG_synthase_C | 0.93 |
PF10009 | DUF2252 | 0.93 |
PF00884 | Sulfatase | 0.93 |
PF04402 | SIMPL | 0.93 |
PF04545 | Sigma70_r4 | 0.93 |
PF00561 | Abhydrolase_1 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.74 |
COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 2.80 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 2.80 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.87 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.93 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.93 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.93 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.93 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.93 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.93 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.93 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.93 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.93 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.93 |
COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.93 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.42 % |
Unclassified | root | N/A | 34.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_100605636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 1437 | Open in IMG/M |
3300001431|F14TB_100768119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 591 | Open in IMG/M |
3300004463|Ga0063356_102349057 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300004479|Ga0062595_102203396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
3300005354|Ga0070675_101642848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga oryzae | 593 | Open in IMG/M |
3300005365|Ga0070688_101820308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 500 | Open in IMG/M |
3300005440|Ga0070705_101940467 | Not Available | 502 | Open in IMG/M |
3300005466|Ga0070685_10036696 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
3300005764|Ga0066903_100468574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2116 | Open in IMG/M |
3300005764|Ga0066903_103962785 | Not Available | 794 | Open in IMG/M |
3300005842|Ga0068858_100028848 | All Organisms → cellular organisms → Bacteria | 5153 | Open in IMG/M |
3300006358|Ga0068871_100964923 | Not Available | 792 | Open in IMG/M |
3300006579|Ga0074054_10970599 | Not Available | 585 | Open in IMG/M |
3300006881|Ga0068865_100087316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2254 | Open in IMG/M |
3300009012|Ga0066710_100752777 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300009101|Ga0105247_10532449 | Not Available | 861 | Open in IMG/M |
3300009545|Ga0105237_11491911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300009789|Ga0126307_11384783 | Not Available | 570 | Open in IMG/M |
3300009840|Ga0126313_10592426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
3300009840|Ga0126313_10951464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
3300009840|Ga0126313_11589143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300010036|Ga0126305_10907412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
3300010037|Ga0126304_10396531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
3300010037|Ga0126304_10820546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300010038|Ga0126315_10773216 | Not Available | 631 | Open in IMG/M |
3300010042|Ga0126314_10892678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 657 | Open in IMG/M |
3300010145|Ga0126321_1468646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
3300010166|Ga0126306_10004037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8621 | Open in IMG/M |
3300010166|Ga0126306_10419748 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300010373|Ga0134128_11866381 | Not Available | 661 | Open in IMG/M |
3300010403|Ga0134123_10315683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga oryzae | 1393 | Open in IMG/M |
3300012004|Ga0120134_1058617 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012019|Ga0120139_1094772 | Not Available | 745 | Open in IMG/M |
3300012204|Ga0137374_10828559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300012204|Ga0137374_11163748 | Not Available | 543 | Open in IMG/M |
3300012206|Ga0137380_10018748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6346 | Open in IMG/M |
3300012206|Ga0137380_11761323 | Not Available | 503 | Open in IMG/M |
3300012349|Ga0137387_10098194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 2037 | Open in IMG/M |
3300012350|Ga0137372_11199906 | Not Available | 512 | Open in IMG/M |
3300012360|Ga0137375_11305970 | Not Available | 547 | Open in IMG/M |
3300012469|Ga0150984_101140612 | Not Available | 1239 | Open in IMG/M |
3300012469|Ga0150984_102378207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus panaciterrae | 1053 | Open in IMG/M |
3300012469|Ga0150984_122134601 | Not Available | 546 | Open in IMG/M |
3300012478|Ga0157328_1021272 | Not Available | 550 | Open in IMG/M |
3300012481|Ga0157320_1003010 | Not Available | 995 | Open in IMG/M |
3300012494|Ga0157341_1009268 | Not Available | 817 | Open in IMG/M |
3300012507|Ga0157342_1002401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1517 | Open in IMG/M |
3300012939|Ga0162650_100077576 | Not Available | 572 | Open in IMG/M |
3300012955|Ga0164298_10012662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3351 | Open in IMG/M |
3300012958|Ga0164299_11476837 | Not Available | 529 | Open in IMG/M |
3300012987|Ga0164307_11699907 | Not Available | 535 | Open in IMG/M |
3300012989|Ga0164305_10070551 | Not Available | 2134 | Open in IMG/M |
3300012989|Ga0164305_11753900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300013102|Ga0157371_11335656 | Not Available | 555 | Open in IMG/M |
3300013297|Ga0157378_11274920 | Not Available | 775 | Open in IMG/M |
3300015077|Ga0173483_10421580 | Not Available | 691 | Open in IMG/M |
3300015371|Ga0132258_10733220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2489 | Open in IMG/M |
3300015371|Ga0132258_10946360 | Not Available | 2176 | Open in IMG/M |
3300015372|Ga0132256_100079820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3127 | Open in IMG/M |
3300015374|Ga0132255_101979882 | Not Available | 887 | Open in IMG/M |
3300017965|Ga0190266_10653756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
3300017997|Ga0184610_1292206 | Not Available | 537 | Open in IMG/M |
3300018000|Ga0184604_10340714 | Not Available | 533 | Open in IMG/M |
3300018028|Ga0184608_10156289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 985 | Open in IMG/M |
3300018028|Ga0184608_10362111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300018061|Ga0184619_10170422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 997 | Open in IMG/M |
3300018072|Ga0184635_10046290 | Not Available | 1672 | Open in IMG/M |
3300018073|Ga0184624_10146568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1036 | Open in IMG/M |
3300018073|Ga0184624_10222520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
3300018076|Ga0184609_10483633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300018078|Ga0184612_10081804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1686 | Open in IMG/M |
3300018081|Ga0184625_10262775 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300018432|Ga0190275_12579869 | Not Available | 585 | Open in IMG/M |
3300018466|Ga0190268_11100838 | Not Available | 646 | Open in IMG/M |
3300019377|Ga0190264_10237751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1044 | Open in IMG/M |
3300019767|Ga0190267_10235136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
3300019869|Ga0193705_1076583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 651 | Open in IMG/M |
3300021078|Ga0210381_10115298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 885 | Open in IMG/M |
3300022534|Ga0224452_1070806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
3300022694|Ga0222623_10150509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 906 | Open in IMG/M |
3300025926|Ga0207659_10576302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300025929|Ga0207664_10092664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2480 | Open in IMG/M |
3300025931|Ga0207644_11807251 | Not Available | 511 | Open in IMG/M |
3300025932|Ga0207690_10146621 | Not Available | 1746 | Open in IMG/M |
3300028718|Ga0307307_10005924 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
3300028719|Ga0307301_10219668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
3300028722|Ga0307319_10066176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1142 | Open in IMG/M |
3300028744|Ga0307318_10029148 | Not Available | 1793 | Open in IMG/M |
3300028744|Ga0307318_10047242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1422 | Open in IMG/M |
3300028744|Ga0307318_10101312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 974 | Open in IMG/M |
3300028744|Ga0307318_10161654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
3300028754|Ga0307297_10198497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 700 | Open in IMG/M |
3300028771|Ga0307320_10026645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2098 | Open in IMG/M |
3300028782|Ga0307306_10199537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 572 | Open in IMG/M |
3300028784|Ga0307282_10015318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3149 | Open in IMG/M |
3300028796|Ga0307287_10066894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 1336 | Open in IMG/M |
3300028814|Ga0307302_10091172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 1450 | Open in IMG/M |
3300030006|Ga0299907_10207346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1617 | Open in IMG/M |
3300030006|Ga0299907_10462841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
3300030496|Ga0268240_10014179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1417 | Open in IMG/M |
3300031092|Ga0308204_10010996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
3300031545|Ga0318541_10817561 | Not Available | 520 | Open in IMG/M |
3300031548|Ga0307408_102288978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300031720|Ga0307469_10051485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2591 | Open in IMG/M |
3300031764|Ga0318535_10345589 | Not Available | 665 | Open in IMG/M |
3300031901|Ga0307406_10033043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 3163 | Open in IMG/M |
3300032080|Ga0326721_10647690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 648 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.28% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 10.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.54% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 3.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1006056363 | 3300000956 | Soil | MRNRPLDAKAFGLLVATSIVLTGAVVVWMFRRWTNHDVSDPGVTL* |
F14TB_1007681192 | 3300001431 | Soil | LDAKAFGLMAVLLLLAGVVLLWIRRRTWTDHNVSDPGVTL* |
Ga0063356_1023490572 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGNRRLDAKAFGLIAALLVLTGAVLLWVRRRTWTDHNVSDPGITL* |
Ga0062595_1022033961 | 3300004479 | Soil | MGNRRLDVKAFGLAAVSLLLTGAVVVWMLRRWTNHDVSDPGVTL* |
Ga0070675_1016428481 | 3300005354 | Miscanthus Rhizosphere | MGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL* |
Ga0070688_1018203081 | 3300005365 | Switchgrass Rhizosphere | VGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL* |
Ga0070705_1019404671 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL* |
Ga0070685_100366965 | 3300005466 | Switchgrass Rhizosphere | GNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL* |
Ga0066903_1004685745 | 3300005764 | Tropical Forest Soil | MGNQRIPGKAFGLGVAALLLTGAVVVWLLRRWTNHDVSDPGVTL* |
Ga0066903_1039627852 | 3300005764 | Tropical Forest Soil | MGNRPLDVKAFGLLAVSLVLTGAAVVWMYRRWTNHDVSDPGVTL* |
Ga0068858_1000288486 | 3300005842 | Switchgrass Rhizosphere | MGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVSL* |
Ga0068871_1009649233 | 3300006358 | Miscanthus Rhizosphere | GNRRLDVKAFGLAAVSLLLTGAVVVCMVRRWTNHDVSDPGVTL* |
Ga0074054_109705992 | 3300006579 | Soil | MGNRRLDVKAFGLAAVSLLLTGAVVVWSLRRWTNHDVSDPGVTL* |
Ga0068865_1000873161 | 3300006881 | Miscanthus Rhizosphere | NRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL* |
Ga0066710_1007527772 | 3300009012 | Grasslands Soil | MGNRRLDAKAFGLLATSLVLTGAVVVWMFRRAWTDHDVSDPGVTL |
Ga0105247_105324492 | 3300009101 | Switchgrass Rhizosphere | MGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVS |
Ga0105237_114919111 | 3300009545 | Corn Rhizosphere | RRPMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWINHDVSDPGVTL* |
Ga0126307_113847832 | 3300009789 | Serpentine Soil | MGNRRLDAKAFGLMAALLLLSGAMLLWIRRKRWTDHNVSDPGVTL* |
Ga0126313_105924262 | 3300009840 | Serpentine Soil | MGNQRSDAKAFGLMAASLVITGAVLVWIFRRAWTNHDVSDPGVAL* |
Ga0126313_109514641 | 3300009840 | Serpentine Soil | LDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL* |
Ga0126313_115891432 | 3300009840 | Serpentine Soil | AKTLGLIAASLVLTGAMVLWARRKWTDHDVSDPGVV* |
Ga0126305_109074122 | 3300010036 | Serpentine Soil | TLGLIAASVVLTGAVVLWARRKWTDHDVSDPGIT* |
Ga0126304_103965312 | 3300010037 | Serpentine Soil | GLMAALLVLTAVVFLWVRRRTSTDHDVSDPGVTL* |
Ga0126304_108205462 | 3300010037 | Serpentine Soil | MGNRRLDAKAFGLIAALLVLTGAVVLWVRRRNWTDHDVSDPGVTL* |
Ga0126315_107732162 | 3300010038 | Serpentine Soil | MGNRRSGAKAFGLIAGLLAVSGAAFFLIRRKRWTDHNVSDPGVTL* |
Ga0126314_108926782 | 3300010042 | Serpentine Soil | MGNRRLDAKAFGLIAALLVLTAAVLVWVRRRTWTDHNVSDPGITL* |
Ga0126321_14686462 | 3300010145 | Soil | MGNRRSGAKAFGLIAALLAVGGVVFLLIRRRWTDHNVSDPGVTL* |
Ga0126306_100040373 | 3300010166 | Serpentine Soil | MGNRRLDAKAFGLMAALLVLIAAAFMWVRRRTSTDHDVSDPGVTL* |
Ga0126306_104197481 | 3300010166 | Serpentine Soil | MGNRRTDAKAFGLIAALLVLAGAVLVWIRRRTSTDHNVSDPGVTL* |
Ga0134128_118663811 | 3300010373 | Terrestrial Soil | LTSAMGNRRLDVKAFGLAAVSLLLTGAVVVCMVRRWTNHDVSDPGVTL* |
Ga0134123_103156833 | 3300010403 | Terrestrial Soil | MGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSEPGVTL* |
Ga0120134_10586171 | 3300012004 | Permafrost | GDGSAAYCRPMGSRRLDAKALGMLAASLALTGAVAVWLFRRAWTDHDVSDPGVTL* |
Ga0120139_10947722 | 3300012019 | Permafrost | MGSRRLDAKALGMLAASLALTGAVVVWMFRRAWTDHDVSDPG |
Ga0137374_108285593 | 3300012204 | Vadose Zone Soil | LGLMGTSLLLTGAVVMWMFRRWTDHNVSDPGVTL* |
Ga0137374_111637481 | 3300012204 | Vadose Zone Soil | MGNRQLNAKAFGLLATSLVLTGAVLVWMFRRAWTDHNVSDPGVT* |
Ga0137380_100187482 | 3300012206 | Vadose Zone Soil | MGNRRLGAKAFGLLASLVLTGAVVVWMFRRGWTDHDVGDPGVTL* |
Ga0137380_117613231 | 3300012206 | Vadose Zone Soil | MGNRRFDAKAFGLLATSLVLTGAVVVWMFRRAWTDHDVSDPGITL* |
Ga0137387_100981941 | 3300012349 | Vadose Zone Soil | AFGLLASLVLTGAVVVWMFRRGWTDHDVGDPGVTL* |
Ga0137372_111999061 | 3300012350 | Vadose Zone Soil | MGNRRLDAKAFGLLATSLLLTGAVVMWMFRRWTDHNVSDPGVTL* |
Ga0137375_113059702 | 3300012360 | Vadose Zone Soil | MGNRQLNAKAFGLLATSLVLTGAVLVWMFRRAWTDHNVSDPGVTL* |
Ga0150984_1011406121 | 3300012469 | Avena Fatua Rhizosphere | AKAFGLIAALLAVSGAVFLLIRRRAWTDHNVSDPGVTL* |
Ga0150984_1023782071 | 3300012469 | Avena Fatua Rhizosphere | MGNRRFDAKAFGLVAALILVSRAVLFWIRRRRWTDHDVSDPGVTL* |
Ga0150984_1221346013 | 3300012469 | Avena Fatua Rhizosphere | AKAFGLVAGLLAVSGAVFLLIRRRRWTDHNVSDPGVTL* |
Ga0157328_10212721 | 3300012478 | Arabidopsis Rhizosphere | MGNRQFDAKVFAVIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0157320_10030102 | 3300012481 | Arabidopsis Rhizosphere | MGNRRFDAKVFAVIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0157341_10092681 | 3300012494 | Arabidopsis Rhizosphere | DAKVFAIIAASVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0157342_10024013 | 3300012507 | Arabidopsis Rhizosphere | MGNRRFDAKVFAIIAASVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0162650_1000775762 | 3300012939 | Soil | MGNRRVNAKAFGLMAALLVLSGAALLWIRRRSWTDHNVSDPGVTL* |
Ga0164298_100126622 | 3300012955 | Soil | MGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVIAPRVTL* |
Ga0164299_114768372 | 3300012958 | Soil | RPMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL* |
Ga0164307_116999072 | 3300012987 | Soil | RRPMGNRRLDVKAFGLAVSLLLTGAVVVWMVRRWTNHDVSDPGVTP* |
Ga0164305_100705513 | 3300012989 | Soil | MGNRRLDVKAFGLAAVSLLLTGAVVLWMVRRWTNHDVSDPGVTL* |
Ga0164305_117539003 | 3300012989 | Soil | MGNRRLDVKAFGLVAILLLLTGAVVVWMLRRWTNHDVSD |
Ga0157371_113356561 | 3300013102 | Corn Rhizosphere | RRPVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL* |
Ga0157378_112749201 | 3300013297 | Miscanthus Rhizosphere | MGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHD |
Ga0173483_104215801 | 3300015077 | Soil | MGNRRLDAKAFGLMAALLVLTGAVLLWIRRRTWTDDNVSDPGVTL* |
Ga0132258_107332201 | 3300015371 | Arabidopsis Rhizosphere | AIIAATVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0132258_109463603 | 3300015371 | Arabidopsis Rhizosphere | MGNRRLAGKAFGLSAVSLLLTGAVLVWMFRRWTDHDVSDPGVTL* |
Ga0132256_1000798205 | 3300015372 | Arabidopsis Rhizosphere | MGNRRFDAKVFAIIAATVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0132255_1019798822 | 3300015374 | Arabidopsis Rhizosphere | MGNRRFDAKVFGIIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL* |
Ga0190266_106537561 | 3300017965 | Soil | AKAFGLMAALLVLTGAVLLWIRRRAWTDHDVSDPGVTL |
Ga0184610_12922061 | 3300017997 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRPWTDHNVSDPGITL |
Ga0184604_103407141 | 3300018000 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0184608_101562892 | 3300018028 | Groundwater Sediment | LDAKAFGLMAALLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0184608_103621112 | 3300018028 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRPWTDHNV |
Ga0184619_101704221 | 3300018061 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAALLVLTGAVLLWVRRRTWTDHNVSDPGITL |
Ga0184635_100462901 | 3300018072 | Groundwater Sediment | LDAKAFGLMAALLVLSGAVLLWIRRRRWTDHNVSDPGVTL |
Ga0184624_101465681 | 3300018073 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRRWTDHNVSDPGVTL |
Ga0184624_102225202 | 3300018073 | Groundwater Sediment | MDAKAFGLMAALLVLTGAVLLWIRRRTSTDHNVSDPGVTL |
Ga0184609_104836331 | 3300018076 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0184612_100818041 | 3300018078 | Groundwater Sediment | LDAKTFGLMTALQVLTAAVLLRIRRRSWTDHNVSDSGVT |
Ga0184625_102627752 | 3300018081 | Groundwater Sediment | MGNRRLDAKAFGLMAALLVLTGAVLFWIRRRSSTDHNVSDPGVTL |
Ga0190275_125798691 | 3300018432 | Soil | LDAKAFGLMAALLVLTGAVLLWIRRRSWTDHNVSDPGVTL |
Ga0190268_111008382 | 3300018466 | Soil | LDAKAFGVIAALLLLIGAVLIWVRRRTWTDHDVSDPGITL |
Ga0190264_102377512 | 3300019377 | Soil | MGNRRLNAKAFGLIATLLVLTGVVLLWIRRRTWRDHDVSDPGITL |
Ga0190267_102351362 | 3300019767 | Soil | MGNRRFAKAFGLFAALLMVSGAVLLWIRRRTWTDHDVSDPGITL |
Ga0193705_10765832 | 3300019869 | Soil | AAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0210381_101152982 | 3300021078 | Groundwater Sediment | LDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0224452_10708062 | 3300022534 | Groundwater Sediment | MDPAAYRRFMGNRRLDAKAFGLIAGLLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0222623_101505091 | 3300022694 | Groundwater Sediment | LDAKAFGLMAAVLVLTGAVLLWMRRRSWTDHNVSDPGVTL |
Ga0207659_105763021 | 3300025926 | Miscanthus Rhizosphere | MGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNH |
Ga0207664_100926644 | 3300025929 | Agricultural Soil | VGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL |
Ga0207644_118072511 | 3300025931 | Switchgrass Rhizosphere | RRPVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL |
Ga0207690_101466214 | 3300025932 | Corn Rhizosphere | WAIDGLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL |
Ga0307307_100059241 | 3300028718 | Soil | GLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0307301_102196682 | 3300028719 | Soil | MDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDH |
Ga0307319_100661762 | 3300028722 | Soil | MGNRRLDAKAFGFIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL |
Ga0307318_100291483 | 3300028744 | Soil | MGNRRLDAKAFGFIATLLVLTGAVLVWVRRRTWTDHNVSDPGITL |
Ga0307318_100472423 | 3300028744 | Soil | MGNRRLDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL |
Ga0307318_101013121 | 3300028744 | Soil | AKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0307318_101616542 | 3300028744 | Soil | MGNRRFDAKAFGLMAALLMVSGAVLLWIRRRTWTDHDVSDPGITL |
Ga0307297_101984971 | 3300028754 | Soil | AFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0307320_100266453 | 3300028771 | Soil | RFDAKAFGLMAALLMVSGAVLLWIRRRTWTDHDVSDPGITL |
Ga0307306_101995371 | 3300028782 | Soil | TASAVDEMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0307282_100153185 | 3300028784 | Soil | MGNRRLDAKAFGLMAALLVLTGAVLLWIRRRIWTDHNVSDPGITL |
Ga0307287_100668942 | 3300028796 | Soil | TGSAVDEMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL |
Ga0307302_100911722 | 3300028814 | Soil | LDAKAFGLMAALLVLSGAVLLWIRRRRWTDHKVSDPGVTL |
Ga0299907_102073461 | 3300030006 | Soil | MGKRRSDAKAFGLMATSLVLTGAVLVWIFRRACTEHDVSDPGVTL |
Ga0299907_104628412 | 3300030006 | Soil | MENRRSGAKVFGLMATSLLLAGAVLVWIFRRARAAHDVSDPGVTL |
Ga0268240_100141791 | 3300030496 | Soil | MENRRSGAKAFGLIAALLAVSGAVFLLIRRRWTDHDVS |
Ga0308204_100109963 | 3300031092 | Soil | MGNRRSGAKAFGVIAALLAVSGAVFFLIRRKRWTDHNVSDPGVTL |
Ga0318541_108175612 | 3300031545 | Soil | PMGNQRIPGKAFGLGAAALLLTGAVVVWLLRRWTNHDVSDPGVTL |
Ga0307408_1022889782 | 3300031548 | Rhizosphere | MGNRRSGAKAFGLIAGLLAVSGAAFFLIRRKTWTDHNVSDPGVTL |
Ga0307469_100514851 | 3300031720 | Hardwood Forest Soil | MGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL |
Ga0318535_103455891 | 3300031764 | Soil | MGNQRIPGKAFGLGAAALLLTGAVVVWLLRRWTNHDVSDPGVTL |
Ga0307406_100330431 | 3300031901 | Rhizosphere | LDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGIT |
Ga0326721_106476901 | 3300032080 | Soil | KSFGLWATSFALAGAFVVWMLRRAWTDHNVSDPGVTL |
⦗Top⦘ |