NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091997

Metagenome / Metatranscriptome Family F091997

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091997
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 55 residues
Representative Sequence MLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAA
Number of Associated Samples 86
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 95.33 %
% of genes from short scaffolds (< 2000 bps) 89.72 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.327 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(59.813 % of family members)
Environment Ontology (ENVO) Unclassified
(70.093 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(59.813 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.06%    β-sheet: 0.00%    Coil/Unstructured: 50.94%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF08281Sigma70_r4_2 90.65
PF07350DUF1479 1.87
PF08241Methyltransf_11 0.93
PF00313CSD 0.93
PF13418Kelch_4 0.93
PF01494FAD_binding_3 0.93
PF13376OmdA 0.93
PF04616Glyco_hydro_43 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.87
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.93
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.93
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.33 %
UnclassifiedrootN/A4.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100279593All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300002245|JGIcombinedJ26739_101457784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300005363|Ga0008090_15687078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300005518|Ga0070699_100162480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1977Open in IMG/M
3300005533|Ga0070734_10007754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8535Open in IMG/M
3300005537|Ga0070730_10155356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1549Open in IMG/M
3300006578|Ga0074059_11971085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300006914|Ga0075436_100756746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300006953|Ga0074063_13907149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300007076|Ga0075435_100439344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1125Open in IMG/M
3300010360|Ga0126372_11961372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300010361|Ga0126378_10740869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1093Open in IMG/M
3300010366|Ga0126379_11233237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300010867|Ga0126347_1080107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300010876|Ga0126361_10515113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1033Open in IMG/M
3300011271|Ga0137393_11440026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300012210|Ga0137378_10423210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1235Open in IMG/M
3300012951|Ga0164300_10196551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300012988|Ga0164306_10900940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300016387|Ga0182040_10359301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1132Open in IMG/M
3300016422|Ga0182039_11505639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300016445|Ga0182038_10969980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300016445|Ga0182038_11181236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia682Open in IMG/M
3300021420|Ga0210394_10636152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia937Open in IMG/M
3300021560|Ga0126371_12109972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300021560|Ga0126371_13517377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300024187|Ga0247672_1090918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300025898|Ga0207692_11175064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae509Open in IMG/M
3300025905|Ga0207685_10304223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300025906|Ga0207699_10041320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2662Open in IMG/M
3300027158|Ga0208725_1012792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1387Open in IMG/M
3300027765|Ga0209073_10482946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300027894|Ga0209068_10884376Not Available528Open in IMG/M
3300028906|Ga0308309_10775003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia833Open in IMG/M
3300031543|Ga0318516_10473501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300031544|Ga0318534_10730830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300031546|Ga0318538_10477106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300031572|Ga0318515_10392199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300031573|Ga0310915_10927534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300031640|Ga0318555_10044704All Organisms → cellular organisms → Bacteria2223Open in IMG/M
3300031640|Ga0318555_10059767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1952Open in IMG/M
3300031640|Ga0318555_10509194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300031668|Ga0318542_10219729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300031680|Ga0318574_10494043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300031713|Ga0318496_10522099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300031713|Ga0318496_10664271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300031723|Ga0318493_10054120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1908Open in IMG/M
3300031724|Ga0318500_10036326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2015Open in IMG/M
3300031736|Ga0318501_10309098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia845Open in IMG/M
3300031736|Ga0318501_10555489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300031736|Ga0318501_10804325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300031744|Ga0306918_11323946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300031747|Ga0318502_10179810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1218Open in IMG/M
3300031747|Ga0318502_10937071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300031748|Ga0318492_10323136All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031748|Ga0318492_10543639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300031764|Ga0318535_10078784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1420Open in IMG/M
3300031764|Ga0318535_10113542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1193Open in IMG/M
3300031768|Ga0318509_10804216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031770|Ga0318521_10145927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1341Open in IMG/M
3300031779|Ga0318566_10171982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1075Open in IMG/M
3300031781|Ga0318547_10332392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia926Open in IMG/M
3300031781|Ga0318547_10953401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300031794|Ga0318503_10097492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300031797|Ga0318550_10173484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300031797|Ga0318550_10258082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia846Open in IMG/M
3300031798|Ga0318523_10599877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300031805|Ga0318497_10840912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300031819|Ga0318568_10636954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300031820|Ga0307473_11331526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300031821|Ga0318567_10111110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1491Open in IMG/M
3300031831|Ga0318564_10068090All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300031860|Ga0318495_10148600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1056Open in IMG/M
3300031879|Ga0306919_10435374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1008Open in IMG/M
3300031890|Ga0306925_11892685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300031893|Ga0318536_10567662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031896|Ga0318551_10389189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300031910|Ga0306923_11594354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300031912|Ga0306921_10098643All Organisms → cellular organisms → Bacteria3383Open in IMG/M
3300031912|Ga0306921_12327236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora thailandica561Open in IMG/M
3300031941|Ga0310912_10162685All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300031945|Ga0310913_11140699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300031954|Ga0306926_11570480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia756Open in IMG/M
3300032001|Ga0306922_11002183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300032010|Ga0318569_10463143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300032044|Ga0318558_10004892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4672Open in IMG/M
3300032044|Ga0318558_10470673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300032044|Ga0318558_10547699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes atraurantiacus578Open in IMG/M
3300032054|Ga0318570_10107400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1223Open in IMG/M
3300032059|Ga0318533_10929167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300032060|Ga0318505_10589973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300032066|Ga0318514_10715233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300032067|Ga0318524_10357146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300032067|Ga0318524_10374053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia741Open in IMG/M
3300032068|Ga0318553_10218254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300032068|Ga0318553_10545926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300032068|Ga0318553_10587905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300032068|Ga0318553_10625730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300032089|Ga0318525_10060786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1887Open in IMG/M
3300032261|Ga0306920_102214662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300032895|Ga0335074_10166981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2751Open in IMG/M
3300033289|Ga0310914_11001712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300033290|Ga0318519_10998426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil59.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10027959313300002245Forest SoilMLEDNLKTLFTLEAEADQPPSHISVPAAGYSARKRRRRRRAVTIGSPVLAAAAGI
JGIcombinedJ26739_10145778423300002245Forest SoilMLEDNLKALFTLEAEADQPPSHISVPAAGRSARQRRRRRRAVTIGSPVLAAAAVIAVIATSIA
Ga0008090_1568707813300005363Tropical Rainforest SoilMLEDNLRTLFTLEAETDQPPSHISVPAADRSARVRQRLQRALAIG
Ga0070699_10016248013300005518Corn, Switchgrass And Miscanthus RhizosphereMLEDNLRTLFTVEAAADQPPSHISVPAAGRSARVRQRLQRALTIGSP
Ga0070734_1000775413300005533Surface SoilMLEDNLRTLFTLEAEADQPPSHISVPAAGHSARVRQRLQRALTIGS
Ga0070730_1015535613300005537Surface SoilMLEDDLRTLFTLEAEVDQPPSHISVPAAGRSARMRQRQRRALTIASPLLATA
Ga0074059_1197108513300006578SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAATVTAVIVTSVALGGGGE
Ga0075436_10075674623300006914Populus RhizosphereMLEDNLRTLFTVEAAADPPPSHISVPAAGRSARVRQRLQRALTIGGPLLAAAAVTAVI
Ga0074063_1390714923300006953SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAATVTAVI
Ga0075435_10043934413300007076Populus RhizosphereMLEDNLRTLFTIEAEADQPPSRISVPAAGRSARVRQRLQRALTIGSPVLAAAAVTAVI
Ga0126372_1196137213300010360Tropical Forest SoilMLEDNLRTLFTLEAEADQPSSHISVPAAGRSARVRQRLWRALTIGSPVLA
Ga0126378_1074086913300010361Tropical Forest SoilMLEDNLRTLFTLEAEADQPPSHISVPAAGRSARVRQRLERTLTIGSPLLAAAAVTAVIATSVALGGGGERIARPTGPAPA
Ga0126379_1123323713300010366Tropical Forest SoilMLEDDLRTLFTLEAEADQPLSHISVPAAGRSARVRRRLQRALTIGNPVLAAAAVTAVIVTSVVLVGGGQRS
Ga0126347_108010713300010867Boreal Forest SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAA
Ga0126361_1051511323300010876Boreal Forest SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIATSVALGGGGE
Ga0137393_1144002613300011271Vadose Zone SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIAASVALGGGGDRI
Ga0137378_1042321033300012210Vadose Zone SoilMLEDNLRTLFTVEAAADQPPSHISVPVAGRSARVRQRLQRALT
Ga0164300_1019655123300012951SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQR
Ga0164306_1090094013300012988SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQ
Ga0182040_1035930133300016387SoilMLEDNLRTLFTLEAGADQPPSPISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAV
Ga0182039_1150563913300016422SoilMLEDNLRTLFTLEAEADQPPSHISVPAAGRSARMR
Ga0182038_1096998023300016445SoilMLEDNLRTLFTLEAGADQPPSPISVPAAGRSARVR
Ga0182038_1118123613300016445SoilMLEDNLRTLFTLEAAADQPPSQISMPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVVATSFALFGG
Ga0210394_1063615213300021420SoilMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIA
Ga0126371_1210997213300021560Tropical Forest SoilMLEDNLRMLFTLEAETDQPPSHISVPAAGRSARVRQRLLRALTIGSPALAAAAVIAVVATSVAITG
Ga0126371_1351737723300021560Tropical Forest SoilMLEDNLRTLFTLEAEADQPPSHVSVPAADRSARVRRRLQRALTIGSPVLAAAAVTAVIVTSV
Ga0247672_109091823300024187SoilMLEDSLRTLFTAEAEADQPPSHISVPAAGRSARARRRLQRAFTIGSPLLAAAAVTAVIATSVALGGGGQRIA
Ga0207692_1117506413300025898Corn, Switchgrass And Miscanthus RhizosphereMLEDNLRTLFTVEAAADPPPSHISVPAAGRSARVRQRLQRALTIGGPLLAAAAVTAV
Ga0207685_1030422313300025905Corn, Switchgrass And Miscanthus RhizosphereMLEDNLRTLFTVEAAADPPPSHISVPAAGRSARVRQRLQRALTIG
Ga0207699_1004132013300025906Corn, Switchgrass And Miscanthus RhizosphereMLEDNLRTLFTVEAAADPPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAA
Ga0208725_101279213300027158Forest SoilMLEDNLKALFTLEAEADQPPSQISVPAAGHSALQRRRRRRAVTIGSPVLAA
Ga0209073_1048294623300027765Agricultural SoilMLEDNLRTLFALEAEADQPPSQISVPAASRSARVRQRLQRILTIGSPVLAAAAVT
Ga0209068_1088437613300027894WatershedsMLEDNLRTLFTVEAEADQPPSHISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIATSVALGGGRKQGAADSK
Ga0308309_1077500323300028906SoilMLEDNLKTLFTLEAEADQPPSHISVPAAGYSARKRRR
Ga0318516_1047350113300031543SoilMLEDNLRTLFTLETQADQPPSHISVPVASRSARGRQRLWRALTIGSPALAAAAVIAVV
Ga0318534_1073083023300031544SoilMLEDHLRTLFTLEAEADQPPSPINVPAAGRNARVRQRRQR
Ga0318538_1047710613300031546SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVL
Ga0318515_1039219913300031572SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGS
Ga0310915_1092753413300031573SoilMLEDNLRTLFTLEAGADQPPSPISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVA
Ga0318555_1004470433300031640SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLTIGSPVLAAAAVTA
Ga0318555_1005976713300031640SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRAL
Ga0318555_1050919423300031640SoilMFEDNLRTLFTLEAEADQPPSQISVPVAGRNARVRQRRRRALMIGSPVLAAAAVIAVIATSVALAGGGER
Ga0318542_1021972933300031668SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRALTIG
Ga0318574_1049404313300031680SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIAT
Ga0318496_1052209923300031713SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVALVGGGQRTP
Ga0318496_1066427123300031713SoilMLEDNLRTLFTLEAEADQPPSHISVPAAGRSARVRQRLQRTVTVGSPLLAAAAVT
Ga0318493_1005412043300031723SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIATSVALGSGGERTPSRA
Ga0318500_1003632643300031724SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRALTIGSPLLAAAAVTAVIATAAEG
Ga0318501_1030909823300031736SoilMFEDNLRTLFTLEAEADQPPSQISVPVAGRNARVRQRRRRALM
Ga0318501_1055548913300031736SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVA
Ga0318501_1080432513300031736SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGPSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGERI
Ga0306918_1132394613300031744SoilMLEDNLRTLFTLEAAADQPPSQISMPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVALVGGGQ
Ga0318502_1017981013300031747SoilMLEDNLRTLFTLEAAADQPPSHISVPAAGRSARMRQRQRRALTIGS
Ga0318502_1093707113300031747SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVALVGGGQR
Ga0318492_1032313623300031748SoilMLEDHLRTLFTLEAEADQPPSPINVPAAGRNARVRQRRQRALMIGSPVLAAAAVIAVIATSFALAGGGEKIPQPARR
Ga0318492_1054363913300031748SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGPSARMRQRLQRALTIG
Ga0318535_1007878433300031764SoilMLEDNLRTLFTLEATADQPPSHISVPVAGRSARGRQRLWRALTLSSPALA
Ga0318535_1011354213300031764SoilMLEDNLRMLFTLEAGADQPPSPISVPAAGRSARVRQRLQRALIIGSPV
Ga0318509_1080421623300031768SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLTIGSPVLAAAAVTAVVATSVALSG
Ga0318521_1014592723300031770SoilMLEDNLRTLFTLEATADQPPSHISVPVAGRSARGRQRLWRALTLS
Ga0318566_1017198213300031779SoilMLEDSLRTLFTLEAEADQPPSHISVPAAGRSARMRRRLQRALT
Ga0318547_1033239213300031781SoilMLEDNLRTLFTLEAAADQPPSQISMPAAGRSARVRQRLQ
Ga0318547_1095340113300031781SoilMLEDNLRTLFTLEAEAGQPPSHISVPAAGRSARVRRRLQRALGVGSPLLAAAAV
Ga0318503_1009749213300031794SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLTIGS
Ga0318550_1017348433300031797SoilMLEDDLRTLFTLEAEADQPPSQISVPAAGRSARVRQRLQRALTI
Ga0318550_1025808223300031797SoilMLEDNLRTLFTLEATADQPPSHISVPVAGRSARRRQRLWRALTLSSPALAAAAVIAVVATSVALTGG
Ga0318523_1059987713300031798SoilMLEDNLRTLFTLEAQADQPPSQISVPAAGRSARVRQRLQRALTIGSPL
Ga0318497_1076747613300031805SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGERIPRPAKQA
Ga0318497_1084091223300031805SoilMLEDNLRTLFTREAEADQPPPHISVPAAARSARARQRQRRALTIGSPVLAAAAV
Ga0318568_1063695423300031819SoilMLEDNLRTLFTLEAEADQPPSYISVPAAGRSARVRQRLQRTLTIGSPVLAAAAV
Ga0307473_1133152623300031820Hardwood Forest SoilMLEDNLRTLFTVEAAADPPPSHISVPAAGRSARVRQRLQRALTI
Ga0318567_1011111033300031821SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLTIGSPVLAAAAVTAVVATSVA
Ga0318564_1006809033300031831SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLTIGSPVLAAAGEGDPG
Ga0318499_1016854323300031832SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGERIPRPAKQ
Ga0318495_1014860013300031860SoilMLEDNLRMLFTLEAGADQPPSPISVPAAGRSARVRQRLQRALIIGSPVL
Ga0306919_1043537413300031879SoilMLEDNLRMLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSPV
Ga0306925_1189268513300031890SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLL
Ga0318536_1056766213300031893SoilMLEDYLRTLFTLEAAADQPPSHISVPAAGRSARMRQRQRRALTIGSPVLAAAAVIVVIAT
Ga0318551_1038918923300031896SoilMLEDYLRTLFTLEAAADQPPSHISVPAAGRSARMRQRQRRALTIGSPVLAAAAVIVVI
Ga0306923_1159435423300031910SoilMLEDNLRTLFTREAEADQPPPHISVPAAARSARARQRQRRALTIGSP
Ga0306921_1009864313300031912SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRVLT
Ga0306921_1232723613300031912SoilMLEDDLRTLFTLEAEADQPPSCISVPAAGRSARVRQRLQRALI
Ga0310912_1016268513300031941SoilMLEDNLRTLFALEAEADPPMSHISVPAAGRSARMRQRQRRALTIGSPVLAAA
Ga0310913_1114069913300031945SoilMLEDNLRTLFTLEAQAELPPSQISVPAAGRSARVRQRLQRALTIGSPLLAAAAVIAVIAASVALGGG
Ga0306926_1157048013300031954SoilMLEDNLRTLFTREAEADQPPPHISVPAAARSARARQRQ
Ga0306922_1100218323300032001SoilMLEDNLRTLFTLEAEADQPPPHISVPAAARSARARQRQRRALTIGSPVLAAAAV
Ga0318569_1046314323300032010SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVALVGGGQRSAR
Ga0310911_1081087023300032035SoilMLEDDLRALFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGERIPRPAKQARPA
Ga0318558_1000489283300032044SoilMFEDNLRTLFTLEAEADQPPSQISVPVAGRNARVRQRRRRALMIGSPVLAAAAVITVIAT
Ga0318558_1047067313300032044SoilMLEDDLRTLFALEAEADQPPSQISVPAAGGSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGER
Ga0318558_1054769913300032044SoilMLEDNLRTLFTLEATADQPPSHISVPVAGRSARRRQRLWRALTLSS
Ga0318570_1010740033300032054SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIG
Ga0318533_1092916713300032059SoilMLEDNLRTLFTLEAETDQPPSQISVPAAGRSARVRQR
Ga0318505_1058997313300032060SoilMLEDNLRTLFTLEAGADQPPSLISVPAAGRSARVRQRLQRALIIGSP
Ga0318504_1050429313300032063SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLLAAAAVIAVIAASFALLGGGERIPRPAKQARPAT
Ga0318514_1071523323300032066SoilMLEDSLRTLFTLEAEADQPPSHISVPAAGRSARMRRRLQRALTIGSPVLAAAAV
Ga0318524_1035714623300032067SoilMLEDNLRTLFTLEATADQPPSHISVPVAGRSARRRQRLWRALTLSSPALAAAAVIAVVATSVALTGGGERIARPTG
Ga0318524_1037405313300032067SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQGALTIGSPLL
Ga0318553_1021825413300032068SoilMLEDNLRTLFTLEAETDQPPSQISVPAAGRSARVRQRLLRALTIGSPALAAAAVIAV
Ga0318553_1054592623300032068SoilMLEDNLRMLFTLEAGADQPPSPISVPAAGRSARVRQRLQRALIIGSPVLAAAAVTAVIVASVALVGGGQR
Ga0318553_1058790513300032068SoilMLEDNLRTLFTLEAEADQPPSHISVPLAGRSARVRRRLQRALTLGSPLLAAAAVTAVIATSVALGG
Ga0318553_1062573023300032068SoilMLEDNLRTLFTREAEADQPPPHISVPAAARSARARQRQRRAL
Ga0318525_1006078613300032089SoilMLEDDLRTLFALEAEADQPPSQISVPAAGRSARMRQRLQRALTIGSPLLA
Ga0306920_10221466213300032261SoilMLEDNLRTLFTLEAETDQPPSQISVPAAGRSARVRQRLLRA
Ga0335074_1016698113300032895SoilMLEDNLKTLFTLEAEADQPLSQISVPAAARSARLRQGQ
Ga0310914_1100171213300033289SoilMLEDNLRTLFTLEAETDQPPSYISVPAAGRSARVRQRLQRTLTIGSPVLAAAAVTAVIVTSGALAGGGGR
Ga0318519_1099842613300033290SoilMLEDNLRTLFTLEAEADQPPPHISVPAAARSARARQRQRRALTIGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.