NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091833

Metagenome / Metatranscriptome Family F091833

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091833
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 156 residues
Representative Sequence RHRVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Number of Associated Samples 86
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.81 %
% of genes near scaffold ends (potentially truncated) 40.19 %
% of genes from short scaffolds (< 2000 bps) 80.37 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(57.009 % of family members)
Environment Ontology (ENVO) Unclassified
(83.178 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(90.654 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 8.97%    β-sheet: 34.62%    Coil/Unstructured: 56.41%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00873ACR_tran 12.15
PF13533Biotin_lipoyl_2 5.61
PF13493DUF4118 3.74
PF16694Cytochrome_P460 2.80
PF13188PAS_8 2.80
PF00529CusB_dom_1 1.87
PF08447PAS_3 1.87
PF01297ZnuA 0.93
PF13091PLDc_2 0.93
PF04199Cyclase 0.93
PF01145Band_7 0.93
PF08281Sigma70_r4_2 0.93
PF10944DUF2630 0.93
PF07978NIPSNAP 0.93
PF02321OEP 0.93
PF03783CsgG 0.93
PF02738MoCoBD_1 0.93
PF07883Cupin_2 0.93
PF00881Nitroreductase 0.93
PF08240ADH_N 0.93
PF10518TAT_signal 0.93
PF00561Abhydrolase_1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.87
COG1462Curli biogenesis system outer membrane secretion channel CsgGCell wall/membrane/envelope biogenesis [M] 0.93
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003203|JGI25406J46586_10013476All Organisms → cellular organisms → Bacteria3510Open in IMG/M
3300005166|Ga0066674_10419292All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium617Open in IMG/M
3300005171|Ga0066677_10506200All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium694Open in IMG/M
3300005172|Ga0066683_10010816All Organisms → cellular organisms → Bacteria4788Open in IMG/M
3300005174|Ga0066680_10474582All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium788Open in IMG/M
3300005175|Ga0066673_10307362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3925Open in IMG/M
3300005175|Ga0066673_10598505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300005176|Ga0066679_10365175All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium944Open in IMG/M
3300005177|Ga0066690_10718917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium659Open in IMG/M
3300005178|Ga0066688_10055590All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2304Open in IMG/M
3300005178|Ga0066688_10214797All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300005180|Ga0066685_10019420All Organisms → cellular organisms → Bacteria → Proteobacteria4040Open in IMG/M
3300005180|Ga0066685_10703889All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium693Open in IMG/M
3300005181|Ga0066678_10379035All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium936Open in IMG/M
3300005184|Ga0066671_10077799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1776Open in IMG/M
3300005186|Ga0066676_10028519All Organisms → cellular organisms → Bacteria3004Open in IMG/M
3300005186|Ga0066676_10557044All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium777Open in IMG/M
3300005187|Ga0066675_10308603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31146Open in IMG/M
3300005446|Ga0066686_10610275All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium742Open in IMG/M
3300005450|Ga0066682_10014191All Organisms → cellular organisms → Bacteria4327Open in IMG/M
3300005451|Ga0066681_10072200All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300005540|Ga0066697_10025550All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300005552|Ga0066701_10016146All Organisms → cellular organisms → Bacteria3585Open in IMG/M
3300005554|Ga0066661_10776884All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300005556|Ga0066707_10903990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium541Open in IMG/M
3300005557|Ga0066704_10430692All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium873Open in IMG/M
3300005559|Ga0066700_10277876All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005560|Ga0066670_10455623All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium788Open in IMG/M
3300005561|Ga0066699_10069819All Organisms → cellular organisms → Bacteria2231Open in IMG/M
3300005561|Ga0066699_10307893All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1129Open in IMG/M
3300005561|Ga0066699_11070624All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300005569|Ga0066705_10004683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5840Open in IMG/M
3300005574|Ga0066694_10137707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1154Open in IMG/M
3300005575|Ga0066702_10806519All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300005576|Ga0066708_10841212All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300005586|Ga0066691_10911253All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300005598|Ga0066706_10041721All Organisms → cellular organisms → Bacteria3035Open in IMG/M
3300005598|Ga0066706_10898622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium690Open in IMG/M
3300006031|Ga0066651_10086302All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300006046|Ga0066652_100035991All Organisms → cellular organisms → Bacteria3599Open in IMG/M
3300006049|Ga0075417_10058173All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1686Open in IMG/M
3300006755|Ga0079222_10060680All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1809Open in IMG/M
3300006797|Ga0066659_10229986All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300006797|Ga0066659_11209972All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium631Open in IMG/M
3300006797|Ga0066659_11646048All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300006800|Ga0066660_10448681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1077Open in IMG/M
3300006800|Ga0066660_10528468All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium991Open in IMG/M
3300006804|Ga0079221_10153813All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1207Open in IMG/M
3300006846|Ga0075430_101408212All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300006853|Ga0075420_100050690All Organisms → cellular organisms → Bacteria3696Open in IMG/M
3300009012|Ga0066710_100079833All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium4258Open in IMG/M
3300009012|Ga0066710_101309728All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300010117|Ga0127449_1079236All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300010122|Ga0127488_1157713All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300010141|Ga0127499_1164046All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300010142|Ga0127483_1158293All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium878Open in IMG/M
3300010145|Ga0126321_1166632All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium771Open in IMG/M
3300010303|Ga0134082_10113210All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1080Open in IMG/M
3300010320|Ga0134109_10062245All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300010320|Ga0134109_10087023All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1075Open in IMG/M
3300010321|Ga0134067_10100939All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium987Open in IMG/M
3300010333|Ga0134080_10472645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300010335|Ga0134063_10056700All Organisms → cellular organisms → Bacteria → Proteobacteria1721Open in IMG/M
3300010335|Ga0134063_10587331All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300010337|Ga0134062_10174912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3967Open in IMG/M
3300012211|Ga0137377_11011425All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium762Open in IMG/M
3300012385|Ga0134023_1130518All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300012392|Ga0134043_1299445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300012402|Ga0134059_1017318All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300012410|Ga0134060_1470177All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300012469|Ga0150984_118287673All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300012930|Ga0137407_10964061All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium807Open in IMG/M
3300012975|Ga0134110_10217933All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium805Open in IMG/M
3300015357|Ga0134072_10292836All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium604Open in IMG/M
3300015357|Ga0134072_10310914All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300015359|Ga0134085_10243436All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium782Open in IMG/M
3300017654|Ga0134069_1066123All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1151Open in IMG/M
3300017654|Ga0134069_1304684All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium565Open in IMG/M
3300018433|Ga0066667_10945893All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium742Open in IMG/M
3300018433|Ga0066667_11700595All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300018482|Ga0066669_10104632All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1975Open in IMG/M
3300018482|Ga0066669_10378884All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1188Open in IMG/M
3300025910|Ga0207684_10243195All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1552Open in IMG/M
3300026306|Ga0209468_1038739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31643Open in IMG/M
3300026309|Ga0209055_1224872All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300026314|Ga0209268_1155182All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium562Open in IMG/M
3300026318|Ga0209471_1006116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium6526Open in IMG/M
3300026318|Ga0209471_1061716All Organisms → cellular organisms → Bacteria1703Open in IMG/M
3300026323|Ga0209472_1125860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3997Open in IMG/M
3300026324|Ga0209470_1078564All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300026324|Ga0209470_1303041All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300026327|Ga0209266_1009877All Organisms → cellular organisms → Bacteria5554Open in IMG/M
3300026329|Ga0209375_1019969All Organisms → cellular organisms → Bacteria3867Open in IMG/M
3300026329|Ga0209375_1126482All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1116Open in IMG/M
3300026343|Ga0209159_1104066All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1230Open in IMG/M
3300026524|Ga0209690_1005992All Organisms → cellular organisms → Bacteria → Proteobacteria6780Open in IMG/M
3300026529|Ga0209806_1073222All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1535Open in IMG/M
3300026530|Ga0209807_1084541All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1398Open in IMG/M
3300026536|Ga0209058_1312873All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium541Open in IMG/M
3300026547|Ga0209156_10390941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium584Open in IMG/M
3300026547|Ga0209156_10418240All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300026548|Ga0209161_10197325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1117Open in IMG/M
3300026555|Ga0179593_1105344All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300027748|Ga0209689_1052378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2281Open in IMG/M
3300027775|Ga0209177_10069778All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1047Open in IMG/M
3300027787|Ga0209074_10026886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1612Open in IMG/M
3300027873|Ga0209814_10014205All Organisms → cellular organisms → Bacteria3173Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil57.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil20.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.80%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25406J46586_1001347633300003203Tabebuia Heterophylla RhizosphereMRHRTFIVALGVVVLTALVTGCAGVGSRIDGSASGNASDLPGALELSGAWQGSYWQLPMGNSYADAADCTLRINEDATFTASCARPLIGTNNLAKASSWSGRVVTHGNRITLQGNGGPWPWIVLTRSGADTLYGVTLDPQVGATVEMEFERESMPAATPRGN*
Ga0066674_1041929213300005166SoilLAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYRQLGMAYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066677_1050620023300005171SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEME
Ga0066683_1001081613300005172SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGT
Ga0066680_1047458223300005174SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHCVWTTGRL
Ga0066673_1030736213300005175SoilMGAVISMVAVLVLLAGCAGPSSRIGGSGGASALPGARELSGTWHGSYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0066673_1059850513300005175SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTDGK*
Ga0066679_1036517523300005176SoilMNRHRFISTLALVTLIAGCAGPSARIGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAGAGRN*
Ga0066690_1071891713300005177SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAGAGRN*
Ga0066688_1005559023300005178SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN*
Ga0066688_1021479723300005178SoilMGALISMVAVLVLLAGCAGPSSRIGGSGGASALPGARELSGTWHGSYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGDDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA*
Ga0066685_1001942033300005180SoilRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSEGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0066685_1070388913300005180SoilAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTYIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGGTMYGTTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066678_1037903513300005181SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPTVGATVEMNFEREPNTAAGAGSN*
Ga0066671_1007779933300005184SoilVAGCAGPSAHISGSGSREDGSALPAERDFTGTWQGSYWQLGMVYYDDDADCTLQIKEDSTFIAKCTRSSVGTNNIAKSSSWSGRVVTKGNSIVLQDNGGPWPSIMLRRSANGTLYGTTLDPLVGATIEMEFERDTHTITGGGGA*
Ga0066676_1002851923300005186SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0066676_1055704413300005186SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066675_1030860323300005187SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERGPNTAAGAGARSPHRV*
Ga0066686_1061027513300005446SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTYIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066682_1001419133300005450SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0066681_1007220023300005451SoilMGALISIVALLVLLAGCAGPSSRIGSSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0066697_1002555013300005540SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSTWSGHVVTTANGIVLQDNGGPWPSIVLRRHGGTMYGTTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066701_1001614623300005552SoilMGALISMVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA*
Ga0066661_1077688413300005554SoilGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAGAGRN*
Ga0066707_1090399013300005556SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066704_1043069213300005557SoilMNRHRFISTLALVTLIAGCAGPSARIGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN*
Ga0066700_1027787623300005559SoilMRQRAISTLAVFAVFALIAGCAAPSTHVSGSLSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFVAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066670_1045562323300005560SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGDVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066699_1006981923300005561SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFVAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066699_1030789323300005561SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDALYGVTLDPPVGATVEMNFEREPNTAAGTGSN*
Ga0066699_1107062413300005561SoilMGTLISMVALLALLAGCAGPSSRIGGSAAASALPAARELSGAWHGGYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGDDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA*
Ga0066705_1000468323300005569SoilMRQRAISTLAVFAVFALIAGCAAPSTHVSGSLSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066694_1013770713300005574SoilRMKPLSRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERGPNTAAGAGARSPHRV*
Ga0066702_1080651913300005575SoilMGTLISMVALLALLAGCAGPSSRIGGSGGASALPGARELSGTWHGSYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGDDTLFGVTLDPLVGATIEMEFERAPNTAAGA
Ga0066708_1084121213300005576SoilFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFVAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066691_1091125313300005586SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAG
Ga0066706_1004172123300005598SoilMGALISMVAVLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDAAFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA*
Ga0066706_1089862213300005598SoilSILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066651_1008630223300006031SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPTHLIKAAP*
Ga0066652_10003599123300006046SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERGPNTAAGAGARSPHRV*
Ga0075417_1005817333300006049Populus RhizosphereMIRRAISIVAVLALAAGCAEPSINVSGSGADEAGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKDDSTFTAKCTRSAVGTNNIAMSSSWSGHVVTTAHGVVLQSNGGPWPSIVLRRHGSDTLYATTLDPLVGATVEMEFERGPHTTAGAGGT*
Ga0079222_1006068033300006755Agricultural SoilMRRHRWIPFLALVALVTGCAGPSATVSGAATGDEGSALPTASTLPSPRDFVGTWHGSYWQLGMVYYDDDADCTLQIKEDSTFDVHCTRSSVGTNNIAKSSSWSGRVVTKGHEIVLQDNGGSWPSIALRRSRNGTLYGTTLDPLVGATVEMEFARESHPSASPSLK*
Ga0066659_1022998623300006797SoilMRHGVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKDNVGPWPSIVLRRHGDTMFATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0066659_1120997213300006797SoilVAGCAGPGARIGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN*
Ga0066659_1164604813300006797SoilSRRRRLKDMGALISMVVVLVLLAGCAGPSSRIGGSGGASALPGARELSGTWHGSYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGDDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA*
Ga0066660_1044868123300006800SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARDLSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN*
Ga0066660_1052846823300006800SoilKRFMRQRAISTLAVFAVFALIAGCAAPSTNVSGSLSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0079221_1015381313300006804Agricultural SoilMRRHRWIPFLALVALVTGCAGPSATVSGAATGDEGSALPTASTLPSPRDFVGTWHGAYWQLGMVYYDDDADCTLQIKEDSTFDVHCTRSSVGTNNIAKSSSWSGRVVTKGHEIVLQDNGGSWPSIALRRSRNGTLYGTTLDPLVGATVEMEFARESHPSASPSLK*
Ga0075430_10140821213300006846Populus RhizosphereSGSGADEAGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFTAKCTRSAVGTNNIAMSSSWSGHVVTTAHGVVLQSNGGPWPSIVLRRHGSDTLYATTLDPLVGATVEMEFERGPHTTAGAGGT*
Ga0075420_10005069023300006853Populus RhizosphereMIRRAISIVAVLALAAGCAEPSINVSGSGADEAGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFTAKCTRSAVGTNNIAMSSSWSGHVVTTAHGVVLQSNGGPWPSIVLRRHGSDTLYATTLDPLVGATVEMEFERGPHTTAGAGGT*
Ga0066710_10007983313300009012Grasslands SoilMRRHRLISTLPLVALVAGCAGPGGRIGGSGSGEEGWPLLAARELSGTRRGSYWQLGMMYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDALYGVTLDPPVGATVEMNFEREPNTAAGTGSN
Ga0066710_10130972813300009012Grasslands SoilRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0127449_107923613300010117Grasslands SoilAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0127488_115771313300010122Grasslands SoilRHRVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0127499_116404613300010141Grasslands SoilISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSTWSGHVVTTANGVVLKNNGGPWPSIVLRRHGGTMYGTTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0127483_115829323300010142Grasslands SoilMRHRVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0126321_116663213300010145SoilMKRNRWISFLALVGLVAGCAGPSASIGSSASGEYGSASPAARDFTGTWHGSYWNLPIGNSYGDEADCTLRIREDATFIVKCTRVAWGTNNLARGSSWSGRVVTKGDTIVLQDNGGAWPSIVLRRSSDGTLYGTTVDPLVGATVELELEREPHPSASPAGQ*
Ga0134082_1011321023300010303Grasslands SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSTWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134109_1006224523300010320Grasslands SoilMKPLFRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWQSIVLTRSGNDTLFG
Ga0134109_1008702323300010320Grasslands SoilMRHRVISILAVLALFAGCAAPSTHVSGSLSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134067_1010093913300010321Grasslands SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSTWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTLYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134080_1047264513300010333Grasslands SoilMKPLFRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPPRV*
Ga0134063_1005670023300010335Grasslands SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAQSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134063_1058733113300010335Grasslands SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLEIKDDATFTAKCTRVGWGTNNLAKSSSWSGRVVTKGNRIILQDNGGSWPSIVLTRSDNDTLYGVTLDPPVG
Ga0134062_1017491213300010337Grasslands SoilMKPLFRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFER
Ga0137377_1101142513300012211Vadose Zone SoilMKPLSRRRRLKDVGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDAAFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLYSLDAATTEMEFERAPNTAAGAGARSPHRV*
Ga0134023_113051813300012385Grasslands SoilDMRHGVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134043_129944513300012392Grasslands SoilRDMRHGVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134059_101731813300012402Grasslands SoilGRDMRHRVISISAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134060_147017713300012410Grasslands SoilSIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0150984_11828767313300012469Avena Fatua RhizosphereMRQRAISTLAVFAVFALIAGCAAPSTNVSRSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTLYATTLAPLVGATIEMEFE
Ga0137407_1096406113300012930Vadose Zone SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPNTTAGTGEK*
Ga0134110_1021793313300012975Grasslands SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTLYATTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134072_1029283613300015357Grasslands SoilMGALISIVALLLLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEM
Ga0134072_1031091413300015357Grasslands SoilVSGSLSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLQDNGGPWPSIVLRRHGGTLYGTTLDPLVGATIEMEFERSPHTTAGTGGK*
Ga0134085_1024343613300015359Grasslands SoilMKPLFRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV*
Ga0134069_106612323300017654Grasslands SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0134069_130468413300017654Grasslands SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGA
Ga0066667_1094589313300018433Grasslands SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMFATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0066667_1170059513300018433Grasslands SoilMKPLSRRRRLKDMGALISMVAVLVLLAGCAGPSSRIGGSGGASALPGARELSGTWHGSYWQLGMVYYDDDADCTLGIKDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMAFE
Ga0066669_1010463223300018482Grasslands SoilIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0066669_1037888423300018482Grasslands SoilMRQRAISTVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYGTTLDPLVGATIEMEFEQSPHTTAGTGEK
Ga0207684_1024319523300025910Corn, Switchgrass And Miscanthus RhizosphereMRRHRLISTLALVTLLAGCAGPSARMGGSGSGEEGSALPAARELSGTWHGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSSWSGRVVTKGDRIVLQDNGGPWPSIVLRRSGNDTLYGTTLDPLVGATIEMNFERGPSSASSG
Ga0209468_103873923300026306SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0209055_122487223300026309SoilGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAGAGRN
Ga0209268_115518213300026314SoilRMKPLSRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERGPNTAAGAGARSPHRV
Ga0209471_100611693300026318SoilMRRHRLISTLALVALVAGCAGPGARIGGSGSGEEGSALPAARDLSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN
Ga0209471_106171633300026318SoilMNRHRFISTLALVTLIAGCAGPSARIGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFAATCTRSPVGTNNIAKSSKWSGRVVTKGNRIVLQDNGGPWPSIVLARSGNGTLYGVTLDPLVGATIEMNFEREPNTAAGAGRN
Ga0209472_112586013300026323SoilMGALISIVALLVLLAGCAGPSSRIGSSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERGPNTAAGAGARSPHRV
Ga0209470_107856423300026324SoilMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNGYGMPDSLGAAPDQGRVDVLGRTT
Ga0209470_130304113300026324SoilAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0209266_100987733300026327SoilMRHGVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0209375_101996913300026329SoilMKPLSRRRRLKDMGALISIVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILKDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0209375_112648213300026329SoilMRHRVISILAVLALFAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYGTTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0209159_110406613300026343SoilMRHGVISILAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTG
Ga0209690_100599253300026524SoilMGALISMVALLVLLAGCAGPSSRIGGSGGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGA
Ga0209806_107322243300026529SoilRKERRMNRHRFISTLALVTLIAGCAGPSARIGGSGSSDEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN
Ga0209807_108454113300026530SoilGGSGSGEEGSALPAARELSGTWRGSYWQLGMVYYDDDADCTLRIKEDATFTATCTRSPVGTNNIARSSKWSGRVVTKGNRIVLQDNGGPWPSIVLRRSGKDVLYAVTLDPPVGATVEMNFEREPNTAAGAGSN
Ga0209058_131287313300026536SoilLLVLLAGCAGPSSRIGGSEGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0209156_1039094113300026547SoilMRQRAISTLAVFAVFALIAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0209156_1041824013300026547SoilGGSEGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPNTAAGAGARSPHRV
Ga0209161_1019732523300026548SoilMRQRAISTLAVFAVFALIAGCAAPSTHVSGSFSGGDGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFIAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0179593_110534423300026555Vadose Zone SoilMGALISIVALLVLLAGCAGPSSRIGGSEGASALPGAREFSGTWHGSYWQLGMVYYDDDADCTLRIEDDATFTAKCTRVAWGTNNLARSSSWSGRVVTKGNRVILEDAGGPWPSIVLTRSGNDTLFGVTLDPLVGATIEMEFERAPTTAAGAGARSPHRV
Ga0209689_105237813300027748SoilVRHGVISIVAVLALFAGCAAPSTNVSGSGSGADGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKEDSTFVAKCTRSAVGTNNIAKSSSWSGHVVTTANGIVLKNNGGPWPSIVLRRHGDTMYATTLDPLVGATIEMEFERSPHTTAGTGGK
Ga0209177_1006977823300027775Agricultural SoilMRRHRWIAFLALVALVAGCAGPSATVSGAATGDEGSALPAASTLPSPRDFVGTWHGSYWQLGMVYYDDDADCTLQIKEDSTFDAYCTRSSVGTNNIARSSSWSGRVVMKGHEIVLQDNRGSWPSIALRRSRNGTLYGTTLDPLVGATVEMEFARESHPSASPNLK
Ga0209074_1002688613300027787Agricultural SoilMRRHRWIPFLALVALVTGCAGPSATVSGAATGDEGSALPTASTLPSPRDFVGTWHGAYWQLGMVYYDDDADCTLQIKEDSTFDVHCTRSSVGTNNIAKSSSWSGRVVTKGHEIVLQDNGGSWPSIALRRSRNGTLYGTTLDPLVGATVEMEFARESHPSASPSLK
Ga0209814_1001420563300027873Populus RhizosphereMIRRAISIVAVLALAAGCAEPSINVSGSGADEAGSALPANRDVAGTWQGSYWQLGMVYYADDADCTLQIKDDSTFTAKCTRSAVGTNNIAMSSSWSGHVVTTAHGVVLQSNGGPWPSIVLRRHGSDTLYATTLDPLVGATVEMEFERGPHTTAGAGGT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.