NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091739

Metagenome / Metatranscriptome Family F091739

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091739
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence MRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIK
Number of Associated Samples 91
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 29.91 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 61.68 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.374 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland
(21.495 % of family members)
Environment Ontology (ENVO) Unclassified
(47.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.121 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.28%    β-sheet: 0.00%    Coil/Unstructured: 59.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01416PseudoU_synth_1 2.80
PF02604PhdYeFM_antitox 1.87
PF13578Methyltransf_24 1.87
PF01258zf-dskA_traR 1.87
PF07676PD40 1.87
PF08241Methyltransf_11 1.87
PF00202Aminotran_3 1.87
PF01797Y1_Tnp 1.87
PF01370Epimerase 1.87
PF00106adh_short 0.93
PF04030ALO 0.93
PF04041Glyco_hydro_130 0.93
PF01642MM_CoA_mutase 0.93
PF00196GerE 0.93
PF00149Metallophos 0.93
PF05690ThiG 0.93
PF12696TraG-D_C 0.93
PF13426PAS_9 0.93
PF16757Fucosidase_C 0.93
PF00708Acylphosphatase 0.93
PF14417MEDS 0.93
PF00108Thiolase_N 0.93
PF10101DUF2339 0.93
PF01636APH 0.93
PF00156Pribosyltran 0.93
PF02771Acyl-CoA_dh_N 0.93
PF00027cNMP_binding 0.93
PF16363GDP_Man_Dehyd 0.93
PF00486Trans_reg_C 0.93
PF00011HSP20 0.93
PF03544TonB_C 0.93
PF10102DUF2341 0.93
PF03819MazG 0.93
PF02628COX15-CtaA 0.93
PF01740STAS 0.93
PF00872Transposase_mut 0.93
PF14279HNH_5 0.93
PF06068TIP49 0.93
PF00589Phage_integrase 0.93
PF02682CT_C_D 0.93
PF05167DUF711 0.93
PF01926MMR_HSR1 0.93
PF00248Aldo_ket_red 0.93
PF00580UvrD-helicase 0.93
PF06580His_kinase 0.93
PF04305DUF455 0.93
PF13546DDE_5 0.93
PF13394Fer4_14 0.93
PF01128IspD 0.93
PF14534DUF4440 0.93
PF02310B12-binding 0.93
PF13683rve_3 0.93
PF01709Transcrip_reg 0.93
PF12838Fer4_7 0.93
PF07470Glyco_hydro_88 0.93
PF13502AsmA_2 0.93
PF12704MacB_PCD 0.93
PF00291PALP 0.93
PF13366PDDEXK_3 0.93
PF08530PepX_C 0.93
PF13524Glyco_trans_1_2 0.93
PF08282Hydrolase_3 0.93
PF01351RNase_HII 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 2.80
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 1.87
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.87
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.87
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.87
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG0164Ribonuclease HIIReplication, recombination and repair [L] 0.93
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.93
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.93
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.93
COG0217Transcriptional and/or translational regulatory protein YebC/TACO1Translation, ribosomal structure and biogenesis [J] 0.93
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.93
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.93
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.93
COG0746Molybdopterin-guanine dinucleotide biosynthesis protein ACoenzyme transport and metabolism [H] 0.93
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.93
COG1039Ribonuclease HIIIReplication, recombination and repair [L] 0.93
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.93
COG1207Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferaseCell wall/membrane/envelope biogenesis [M] 0.93
COG12112-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseLipid transport and metabolism [I] 0.93
COG1224DNA helicase TIP49, TBP-interacting proteinTranscription [K] 0.93
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.93
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.93
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.93
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.93
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 0.93
COG20495-oxoprolinase subunit B/Allophanate hydrolase subunit 1Amino acid transport and metabolism [E] 0.93
COG2068CTP:molybdopterin cytidylyltransferase MocACoenzyme transport and metabolism [H] 0.93
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.93
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.93
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.93
COG2833Uncharacterized protein, contains ferritin-like DUF455 domainFunction unknown [S] 0.93
COG2848Uncharacterized conserved protein, UPF0210 familyCell cycle control, cell division, chromosome partitioning [D] 0.93
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.93
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.93
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 0.93
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.93
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.93
COG3973DNA helicase IVReplication, recombination and repair [L] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.37 %
UnclassifiedrootN/A19.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10035801All Organisms → cellular organisms → Bacteria3204Open in IMG/M
3300001867|JGI12627J18819_10123292All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300002917|JGI25616J43925_10145115All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005541|Ga0070733_10304982All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300005561|Ga0066699_10377569All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005574|Ga0066694_10489490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300006031|Ga0066651_10234343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium973Open in IMG/M
3300006034|Ga0066656_10955100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300006794|Ga0066658_10182972All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300007265|Ga0099794_10011751All Organisms → cellular organisms → Bacteria3758Open in IMG/M
3300009012|Ga0066710_101489884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300009548|Ga0116107_1196865Not Available531Open in IMG/M
3300009552|Ga0116138_1029236All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300009615|Ga0116103_1078231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300009629|Ga0116119_1001198All Organisms → cellular organisms → Bacteria11867Open in IMG/M
3300009629|Ga0116119_1001819All Organisms → cellular organisms → Bacteria8594Open in IMG/M
3300009631|Ga0116115_1000687All Organisms → cellular organisms → Bacteria17161Open in IMG/M
3300009634|Ga0116124_1006370All Organisms → cellular organisms → Bacteria5070Open in IMG/M
3300009634|Ga0116124_1103735Not Available804Open in IMG/M
3300009700|Ga0116217_10016781All Organisms → cellular organisms → Bacteria → Acidobacteria5859Open in IMG/M
3300012202|Ga0137363_11405035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300012917|Ga0137395_10174628Not Available1483Open in IMG/M
3300012917|Ga0137395_11049519All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300012918|Ga0137396_10072123All Organisms → cellular organisms → Bacteria → Acidobacteria2415Open in IMG/M
3300012923|Ga0137359_11291887Not Available618Open in IMG/M
3300012984|Ga0164309_10024775All Organisms → cellular organisms → Bacteria → Acidobacteria3207Open in IMG/M
3300014151|Ga0181539_1005310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10463Open in IMG/M
3300014152|Ga0181533_1010248All Organisms → cellular organisms → Bacteria → Acidobacteria7368Open in IMG/M
3300014168|Ga0181534_10134680All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300014495|Ga0182015_10384158All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300014501|Ga0182024_10004124All Organisms → cellular organisms → Bacteria33828Open in IMG/M
3300014838|Ga0182030_11176340Not Available657Open in IMG/M
3300015197|Ga0167638_1102786Not Available543Open in IMG/M
3300017823|Ga0187818_10433400All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300017925|Ga0187856_1000111All Organisms → cellular organisms → Bacteria77363Open in IMG/M
3300017925|Ga0187856_1000389All Organisms → cellular organisms → Bacteria → Acidobacteria40554Open in IMG/M
3300017935|Ga0187848_10000412All Organisms → cellular organisms → Bacteria → Acidobacteria39281Open in IMG/M
3300017935|Ga0187848_10418565Not Available551Open in IMG/M
3300017948|Ga0187847_10344941All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300017959|Ga0187779_11048353All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300017970|Ga0187783_10112202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.2009Open in IMG/M
3300018004|Ga0187865_1008199All Organisms → cellular organisms → Bacteria → Acidobacteria6221Open in IMG/M
3300018005|Ga0187878_1004799All Organisms → cellular organisms → Bacteria → Acidobacteria10302Open in IMG/M
3300018013|Ga0187873_1004004All Organisms → cellular organisms → Bacteria → Acidobacteria10341Open in IMG/M
3300018013|Ga0187873_1177185Not Available805Open in IMG/M
3300018015|Ga0187866_1022307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3218Open in IMG/M
3300018017|Ga0187872_10481754Not Available516Open in IMG/M
3300018020|Ga0187861_10002637All Organisms → cellular organisms → Bacteria → Acidobacteria16618Open in IMG/M
3300018022|Ga0187864_10260843Not Available790Open in IMG/M
3300018042|Ga0187871_10086969All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300018042|Ga0187871_10199516All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1119Open in IMG/M
3300018062|Ga0187784_10243284All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300019787|Ga0182031_1395531All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300020199|Ga0179592_10393734Not Available605Open in IMG/M
3300024330|Ga0137417_1339957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300025160|Ga0209109_10239493All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300025160|Ga0209109_10467987Not Available578Open in IMG/M
3300025419|Ga0208036_1000229All Organisms → cellular organisms → Bacteria40564Open in IMG/M
3300025419|Ga0208036_1003452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4840Open in IMG/M
3300025439|Ga0208323_1004646All Organisms → cellular organisms → Bacteria4115Open in IMG/M
3300025441|Ga0208456_1081848Not Available567Open in IMG/M
3300025442|Ga0208034_1000427All Organisms → cellular organisms → Bacteria35367Open in IMG/M
3300025442|Ga0208034_1002214All Organisms → cellular organisms → Bacteria → Acidobacteria10365Open in IMG/M
3300025442|Ga0208034_1002816All Organisms → cellular organisms → Bacteria8590Open in IMG/M
3300025442|Ga0208034_1005995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4847Open in IMG/M
3300025446|Ga0208038_1000124All Organisms → cellular organisms → Bacteria77406Open in IMG/M
3300025459|Ga0208689_1001918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia10337Open in IMG/M
3300025469|Ga0208687_1074869All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300025472|Ga0208692_1005047Not Available5422Open in IMG/M
3300025477|Ga0208192_1004915All Organisms → cellular organisms → Bacteria5039Open in IMG/M
3300025480|Ga0208688_1000827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia15206Open in IMG/M
3300025812|Ga0208457_1024883All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300026296|Ga0209235_1026844All Organisms → cellular organisms → Bacteria → Acidobacteria3014Open in IMG/M
3300026320|Ga0209131_1405256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300026329|Ga0209375_1097498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1328Open in IMG/M
3300026542|Ga0209805_1162367Not Available1014Open in IMG/M
3300026551|Ga0209648_10050670All Organisms → cellular organisms → Bacteria → Acidobacteria3556Open in IMG/M
3300026557|Ga0179587_10934557Not Available571Open in IMG/M
3300027370|Ga0209010_1011548Not Available1612Open in IMG/M
3300027537|Ga0209419_1035497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium949Open in IMG/M
3300027548|Ga0209523_1108954Not Available573Open in IMG/M
3300027605|Ga0209329_1055461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300027643|Ga0209076_1080240All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300027768|Ga0209772_10119614Not Available817Open in IMG/M
3300027803|Ga0209910_10038342All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027894|Ga0209068_10004626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6494Open in IMG/M
3300027903|Ga0209488_10081470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2409Open in IMG/M
3300027911|Ga0209698_10633376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6819Open in IMG/M
3300028047|Ga0209526_10338503All Organisms → cellular organisms → Bacteria → Acidobacteria1010Open in IMG/M
3300028800|Ga0265338_10115377All Organisms → cellular organisms → Bacteria → Acidobacteria2153Open in IMG/M
3300029889|Ga0246001_1000417All Organisms → cellular organisms → Bacteria → Acidobacteria28334Open in IMG/M
3300029889|Ga0246001_1001939All Organisms → cellular organisms → Bacteria → Acidobacteria10309Open in IMG/M
3300029889|Ga0246001_1002565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8578Open in IMG/M
3300029982|Ga0302277_1078947All Organisms → cellular organisms → Bacteria1487Open in IMG/M
3300030991|Ga0073994_12168571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui957Open in IMG/M
3300031128|Ga0170823_11165064All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300031236|Ga0302324_103310147All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin4527Open in IMG/M
3300031258|Ga0302318_10328024All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300031261|Ga0302140_10469484All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300031469|Ga0170819_16711686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300031754|Ga0307475_10740035All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031962|Ga0307479_11135308All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300031962|Ga0307479_11976343Not Available532Open in IMG/M
3300032261|Ga0306920_101009476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1211Open in IMG/M
3300032261|Ga0306920_103857411All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300032805|Ga0335078_11992786All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300034125|Ga0370484_0206685Not Available538Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland21.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.80%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat2.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.93%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.93%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.93%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027803Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3SEnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1003580113300001356Peatlands SoilMNRETFALSQKELQRVAIISSCVKGDLPCARAAELLDLTPRHVKR
JGI12627J18819_1012329223300001867Forest SoilMNRETFALSQKELQRVEVISASVQGELACARAAELLAITPRHVKR
JGI25616J43925_1014511523300002917Grasslands SoilLSQKELQRVAVISRCVKGELACARAAGLLCLSVRQIKRLKKRMR
Ga0070733_1030498213300005541Surface SoilMKQETFTLSQKELQRVSVISACIKGDMACARAAGLLC
Ga0066699_1037756933300005561SoilMRQETFTLSQKELQRVVVISHCVKGDLACARAAELLDLSPRQVKR
Ga0066694_1048949013300005574SoilLSQKELQRVTVISACIKGDMACARAAGLLCLSVRQ
Ga0066651_1023434323300006031SoilMNRETFSLSQKELQRVAVISACIKGEVACARAAELL
Ga0066656_1095510023300006034SoilMRQETFTLSQKELQRVAVISHCVKGDLVCARAAELLDL
Ga0066658_1018297213300006794SoilMRQETFTLSQKELQRVTVISACIKGDMACARAAGLLCLSVRQSKRLKKRMRED
Ga0099794_1001175163300007265Vadose Zone SoilLSQKELQRVSVINACIRGDMACARAAALLCLSVRQIKRLK
Ga0066710_10148988443300009012Grasslands SoilMRQETFTLSQKELQRVAVISHCVKGDLVCARAAEL
Ga0116107_119686523300009548PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLL
Ga0116138_102923633300009552PeatlandLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLKRRLR
Ga0116103_107823123300009615PeatlandLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLK
Ga0116119_1001198123300009629PeatlandMRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRL
Ga0116119_100181913300009629PeatlandMRQETFTLSQKEMQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRED
Ga0116115_1000687143300009631PeatlandLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQ
Ga0116124_100637063300009634PeatlandMRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIKRLK
Ga0116124_110373513300009634PeatlandMRQETFTLSQKELQRVSVIIACVKVDMACASAAGLLCLSVRQIKRLKRR
Ga0116217_1001678163300009700Peatlands SoilMRQETFPLSQKELQRVSVISTCIKGDMACARAAVLLCLSVR
Ga0137363_1140503523300012202Vadose Zone SoilMRQETFTLSQKELQRVSVINACIRGDMACARAAAL
Ga0137395_1017462813300012917Vadose Zone SoilMNRETFAVSQKELQRVAVISASLKGEVACVRAAEL
Ga0137395_1104951913300012917Vadose Zone SoilMNRETFALSQKELQRVAVISRCVKGELACARAAGLLCLSVRQIKRL
Ga0137396_1007212313300012918Vadose Zone SoilLSQKELQLVSVINACIRGDMACARAAALLCLSVRQIKRLKKRMRED
Ga0137359_1129188723300012923Vadose Zone SoilMRQETFTLSQKELRRVSVINACIRGDMACARAAALLCLSVRQIKRLKKRMRE
Ga0164309_1002477513300012984SoilMRQETFTLSQKELQRVSVINACIKADMACARVAGRLGLGVRLVKRLKKLRRED
Ga0181539_100531013300014151BogMRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLSVRQIK
Ga0181533_101024813300014152BogMRQETFTLSQKELQRVSVITACVKGDMACASAAGL
Ga0181534_1013468033300014168BogMRQETFTLSQKELQRVSVISACIKGDMACARAAVLLCLSVRIKSSIIL
Ga0182015_1038415823300014495PalsaMRQETFTLSQKELQRVTVISQCVQGNLTCARAAELLDLSPR
Ga0182024_1000412413300014501PermafrostMRLETFTLSQKELQRVEVISQCAQGNLACTRAAELLDITPRHV
Ga0182030_1117634013300014838BogMKQETFTLSQKELKRVTVISQCVQGNLTCARAAELL
Ga0167638_110278623300015197Glacier Forefield SoilMNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSV
Ga0187818_1043340023300017823Freshwater SedimentMRQETSPLSKKELQRVSVISACIKGDMACARAAALLCLSVRQIKRL
Ga0187856_100011113300017925PeatlandMRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLS
Ga0187856_1000389483300017925PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0187848_10000412473300017935PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLK
Ga0187848_1041856513300017935PeatlandMRGRTFALSQKELQRVSVISSCVKGDMACARAAELLSLSERHVKRLKKRMREQGEA
Ga0187847_1034494123300017948PeatlandMETYTLSEKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRL
Ga0187779_1104835313300017959Tropical PeatlandMDKGRITLSQRELQRVAVISSCVRGEMACASAAALLSLSVRQVKRLKKR
Ga0187783_1011220233300017970Tropical PeatlandMGQETFTLSQKELQRVVVISQGNLTCVRAAKLLDLSARQVKRLKARYKQ
Ga0187865_100819953300018004PeatlandMRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCL
Ga0187878_100479913300018005PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQI
Ga0187873_100400413300018013PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRR
Ga0187873_117718533300018013PeatlandLSQKELQRVSVIIACVKGDMACASAAGLLCLSVRQIKRLKRR
Ga0187866_102230713300018015PeatlandMRQETFTLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0187872_1048175413300018017PeatlandMRQETFALSQRELQRVAVISSCVKGDLACARAAALLDLTPRL
Ga0187861_1000263713300018020PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKR
Ga0187864_1026084333300018022PeatlandLSQKELQRVSVIIACVKGDMACASAAGLLCLSVRQIK
Ga0187871_1008696913300018042PeatlandMETYTLSEKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRLKARY
Ga0187871_1019951613300018042PeatlandLSAKELQRVSVISSCVKGNLSCASAAKLLAVTPRHVKRLKARY
Ga0187784_1024328433300018062Tropical PeatlandMRQETFRLSQKELQRVAVNSSCVKGDLDCAKAGEL
Ga0182031_139553113300019787BogLSQKELKRVTVISQCVQGNLTCARAAELLDLSPRHVKRLKS
Ga0179592_1039373413300020199Vadose Zone SoilMRRETYTLSQKELQRVSVISACIKGDMACARAAALLCLSVRQIK
Ga0137417_133995733300024330Vadose Zone SoilMRQETFTLSQKELQRVSVINACIRGAMACARAAALLCLSVRPIKRLKKRLR
Ga0209109_1023949313300025160SoilMKQETFTLSQKELQRVAVISAGVKGRLACGRAAALL
Ga0209109_1046798713300025160SoilMRPETFTLSQKELQRVAVISECVRGRLACARAAELLQLSSRHVKRLKLRLRHGGE
Ga0208036_1000229483300025419PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE
Ga0208036_100345273300025419PeatlandMRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0208323_100464613300025439PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQ
Ga0208456_108184813300025441PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLC
Ga0208034_1000427353300025442PeatlandLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0208034_100221413300025442PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0208034_100281683300025442PeatlandLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRL
Ga0208034_100599573300025442PeatlandMRQETFTLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE
Ga0208038_1000124743300025446PeatlandLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKRRLRE
Ga0208689_100191813300025459PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVR
Ga0208687_107486923300025469PeatlandMRQETFTLRQKELQRVSVITACVKGDMACASAAGL
Ga0208692_100504713300025472PeatlandMRQETFTLSQKELQRVSVIIACVKGDMACASAAGLLCLSV
Ga0208192_100491513300025477PeatlandMRQETFTLSRKELQRVNVITACVKGDMACASAAGLLCLS
Ga0208688_1000827193300025480PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQI
Ga0208457_102488313300025812PeatlandLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQ
Ga0209235_102684453300026296Grasslands SoilMRQETFTLSQKELQRVAVISHCVKGDLVCARAAELLDLSPR
Ga0209131_140525613300026320Grasslands SoilMRQETFALSQKELQRVAVISSCVKGELACARAASLLNLTPRHVKRLKSRL
Ga0209375_109749823300026329SoilLSQKELQRVAVISACIKGEMACARAAELLCLSVRQIKRLK
Ga0209805_116236713300026542SoilMRQETFTLSQKELRRVVVISHCVKGDLACARAAELLDLSPRQVKR
Ga0209648_1005067063300026551Grasslands SoilVSVISSCVKGNMACARAAELLSLSVRQVKRLKKRF
Ga0179587_1093455713300026557Vadose Zone SoilVSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIKRLR
Ga0209010_101154823300027370Forest SoilMKQETFALSQKELQRVAVISSCVKGDLTCARAAEL
Ga0209419_103549723300027537Forest SoilMNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIK
Ga0209523_110895423300027548Forest SoilMNRETFGVSQKELQRVAVISACIKGELACARAAELLCLSVRQI
Ga0209329_105546113300027605Forest SoilMNRETFAVSQKELQRVAVISASLKGEVACVRAAELLCLSVRQIKRLRKRMRED
Ga0209076_108024023300027643Vadose Zone SoilMSPMNRETFSLSQKELQRVAVISACIKGEVACARAAELLCLSVR
Ga0209772_1011961413300027768Bog Forest SoilMRQETFTLSQKELQRVSVISACIKGDMACARAAALLCLSVRQIKRLKKRMRE
Ga0209910_1003834213300027803Thawing PermafrostMSQETFHLSQKELQRVAVIAACVKGEVACARAAELLDLTP
Ga0209068_1000462663300027894WatershedsMETYTLSKKELQRVAVISSCVKGDLACARAASLLHLTPRHVKQLKFRLRQGAEAALAHARSP
Ga0209488_1008147013300027903Vadose Zone SoilMNGETFALSQKELQRVAVISRCVKGELACARAAGL
Ga0209698_1063337613300027911WatershedsLSQKELQRVSVISSLAKGDMACARAAELLSLSERHVKRLKK
Ga0209526_1033850313300028047Forest SoilMRQETFTLSQKELQRVSVINACIKGEMACARAAGL
Ga0265338_1011537753300028800RhizosphereVSVISSCVKGDMACARAAALLSLSVRQVKRLKQRLREQ
Ga0246001_1000417363300029889PeatLSRKELQRVSVITACVKGDMACASAAGLLCLSVRQIK
Ga0246001_100193983300029889PeatMRQETFTLRQKELQRVSVITACVKGDMACASAAGLLCLSVRQIK
Ga0246001_100256513300029889PeatLSQKELQRVSVITACVKGDMACASAAGLLCLSVRQIKRLKR
Ga0302277_107894713300029982BogMRGRTYALSQKELQRVSVISSLAKGDMACARAAELLSLSERHVKRLKKR
Ga0073994_1216857113300030991SoilMRQATFPLSQKELQRVSVISACIKIKGDMACASVAELLCLSVRQVKRL
Ga0170823_1116506423300031128Forest SoilMRGRTFALKQKELQRVSVISSCVKGDMACARAAELLSLSIR
Ga0302324_10331014713300031236PalsaVSVISSLAKGNMACARAAELLSLSERHVKRLKKRMR
Ga0302318_1032802413300031258BogMRGRTYALSQKELQRVSVISSLAKGDMACARAAEQRALSERHVKRHKKTIREQGE
Ga0302140_1046948423300031261BogMSQETFHLSQKELQRVAVIAACVKGEVAGARAAERRDLTPRQIKRRKAG
Ga0170819_1671168623300031469Forest SoilMRQETFTLSQKELQRVIVISRCVQGNLTCARAAELLDLSPRPPQ
Ga0307475_1074003513300031754Hardwood Forest SoilMNRETFALSQKELQRVEVISASVQGELACARAAELLAITPRHVKRLKAR
Ga0307479_1113530823300031962Hardwood Forest SoilMSQETFRVSQKELQRVAVIASCVKGDLACARAAELLDLTPRQ
Ga0307479_1197634313300031962Hardwood Forest SoilMNRETFAVSQKELQRVAVISASLKGEVACVRAAEVLCL
Ga0306920_10100947613300032261SoilLNQKELQRVSAIGACIKGDMACASAAELLSLSVRHVKR
Ga0306920_10385741123300032261SoilMRQETFTLNQKELQRVSVIGACIKGDMACASAAELLSLSVRHV
Ga0335078_1199278613300032805SoilMFALSQKELQRVSVISACVKGDMACGRAAAQLSRSK
Ga0370484_0206685_408_5363300034125Untreated Peat SoilMNRETFRLSQKELQRVAVISSCIKGDLACARAAELLAITSRHV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.