NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091664

Metagenome Family F091664

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091664
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 40 residues
Representative Sequence MAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRR
Number of Associated Samples 100
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.20 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 87.85 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.654 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.149 % of family members)
Environment Ontology (ENVO) Unclassified
(33.645 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.252 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.53%    β-sheet: 0.00%    Coil/Unstructured: 51.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07746LigA 59.81
PF07883Cupin_2 24.30
PF06245DUF1015 3.74
PF04238DUF420 0.93
PF01594AI-2E_transport 0.93
PF13188PAS_8 0.93
PF01547SBP_bac_1 0.93
PF00005ABC_tran 0.93
PF02317Octopine_DH 0.93
PF00528BPD_transp_1 0.93
PF02738MoCoBD_1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 3.74
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.93
COG2322Cytochrome oxidase assembly protein CtaM/YozB, DUF420 familyPosttranslational modification, protein turnover, chaperones [O] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.65 %
UnclassifiedrootN/A9.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01DUC7SNot Available500Open in IMG/M
3300000891|JGI10214J12806_10771124All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300000956|JGI10216J12902_117813660All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1028Open in IMG/M
3300005167|Ga0066672_10061749All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300005441|Ga0070700_101772175All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005446|Ga0066686_10048604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2579Open in IMG/M
3300005447|Ga0066689_10694167All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005467|Ga0070706_100645920All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300005467|Ga0070706_101589572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300005526|Ga0073909_10147872All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300005713|Ga0066905_101974145All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005718|Ga0068866_10300102All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1003Open in IMG/M
3300005764|Ga0066903_108528773All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300006797|Ga0066659_11134671All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006800|Ga0066660_10556774All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300006800|Ga0066660_11514286All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006806|Ga0079220_10399874All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300006853|Ga0075420_101418666All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006871|Ga0075434_100150017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2351Open in IMG/M
3300006954|Ga0079219_11252682All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300007258|Ga0099793_10455575All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300009090|Ga0099827_11658174Not Available557Open in IMG/M
3300009092|Ga0105250_10096460All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300009093|Ga0105240_10178337All Organisms → cellular organisms → Bacteria2510Open in IMG/M
3300009148|Ga0105243_12466792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300009174|Ga0105241_10692613All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium929Open in IMG/M
3300009799|Ga0105075_1021194All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium683Open in IMG/M
3300010166|Ga0126306_11031576All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300010358|Ga0126370_11252711All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium692Open in IMG/M
3300010359|Ga0126376_12006105Not Available620Open in IMG/M
3300010366|Ga0126379_12658195All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300010399|Ga0134127_12300511All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium618Open in IMG/M
3300012203|Ga0137399_11684670All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300012209|Ga0137379_11678649Not Available532Open in IMG/M
3300012285|Ga0137370_10985043All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300012357|Ga0137384_10219312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1590Open in IMG/M
3300012359|Ga0137385_11324639All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300012670|Ga0137335_1014326All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012671|Ga0137318_1019568All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012922|Ga0137394_10801094All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300012930|Ga0137407_10400939All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1270Open in IMG/M
3300012972|Ga0134077_10290142All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium685Open in IMG/M
3300013306|Ga0163162_11138509All Organisms → cellular organisms → Bacteria → Proteobacteria885Open in IMG/M
3300014154|Ga0134075_10380833All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium621Open in IMG/M
3300014308|Ga0075354_1116634All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300014324|Ga0075352_1052766All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300014326|Ga0157380_11964529All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium646Open in IMG/M
3300014881|Ga0180094_1037730All Organisms → cellular organisms → Bacteria → Proteobacteria1002Open in IMG/M
3300015245|Ga0137409_10735164All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium822Open in IMG/M
3300015262|Ga0182007_10150351All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300015358|Ga0134089_10040004All Organisms → cellular organisms → Bacteria1682Open in IMG/M
3300015372|Ga0132256_100103811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2773Open in IMG/M
3300015372|Ga0132256_100947366All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300017656|Ga0134112_10006487All Organisms → cellular organisms → Bacteria3765Open in IMG/M
3300017659|Ga0134083_10006819All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3693Open in IMG/M
3300017792|Ga0163161_10904830All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300018076|Ga0184609_10127408All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300018078|Ga0184612_10151677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1212Open in IMG/M
3300018078|Ga0184612_10165757All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1154Open in IMG/M
3300018079|Ga0184627_10141867All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300018084|Ga0184629_10303850All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium840Open in IMG/M
3300018089|Ga0187774_10884513All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300018469|Ga0190270_12598145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300019789|Ga0137408_1149902All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300020004|Ga0193755_1132363All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300020202|Ga0196964_10150833All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1053Open in IMG/M
3300022694|Ga0222623_10063091All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300025160|Ga0209109_10231011Not Available903Open in IMG/M
3300025910|Ga0207684_10014468All Organisms → cellular organisms → Bacteria6802Open in IMG/M
3300025910|Ga0207684_11553917Not Available537Open in IMG/M
3300025913|Ga0207695_10567570All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300025917|Ga0207660_11519936All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium541Open in IMG/M
3300025938|Ga0207704_10461582All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1016Open in IMG/M
3300025961|Ga0207712_11952519Not Available525Open in IMG/M
3300025965|Ga0210090_1020369All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300025981|Ga0207640_10819858All Organisms → cellular organisms → Bacteria → Proteobacteria807Open in IMG/M
3300026075|Ga0207708_11179086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300026118|Ga0207675_100815000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300026361|Ga0257176_1027461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales847Open in IMG/M
3300026480|Ga0257177_1007681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1371Open in IMG/M
3300027209|Ga0209875_1049453All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300027526|Ga0209968_1045611All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium754Open in IMG/M
3300027671|Ga0209588_1218033All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium590Open in IMG/M
3300027787|Ga0209074_10082044All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300027874|Ga0209465_10009280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4353Open in IMG/M
3300027909|Ga0209382_12276845All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300027954|Ga0209859_1071178Not Available553Open in IMG/M
3300028381|Ga0268264_12582835All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium513Open in IMG/M
3300028536|Ga0137415_10877373All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium707Open in IMG/M
3300028809|Ga0247824_10615521All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium654Open in IMG/M
3300028812|Ga0247825_10122628All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1770Open in IMG/M
(restricted) 3300031197|Ga0255310_10014058All Organisms → cellular organisms → Bacteria → Proteobacteria2057Open in IMG/M
3300031231|Ga0170824_103596388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00173213Open in IMG/M
3300031747|Ga0318502_10023157All Organisms → cellular organisms → Bacteria3042Open in IMG/M
3300031770|Ga0318521_10057556All Organisms → cellular organisms → Bacteria2030Open in IMG/M
3300031781|Ga0318547_10158789All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300031949|Ga0214473_11381853All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium717Open in IMG/M
3300032041|Ga0318549_10130378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1111Open in IMG/M
3300032174|Ga0307470_11655618Not Available537Open in IMG/M
3300032180|Ga0307471_100538370All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300032180|Ga0307471_103122829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium587Open in IMG/M
3300032180|Ga0307471_104127825Not Available513Open in IMG/M
3300032205|Ga0307472_100815143All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium854Open in IMG/M
3300032274|Ga0316203_1075342All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300033500|Ga0326730_1074067All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300033811|Ga0364924_150612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300034417|Ga0364941_022070All Organisms → cellular organisms → Bacteria1303Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.80%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.87%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.87%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012670Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2EnvironmentalOpen in IMG/M
3300012671Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014308Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025965Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
E41_028825602170459005Grass SoilMATIVAAMAMTHSPGLTGWFDAAPKGQQEEALRAT
JGI10214J12806_1077112433300000891SoilMARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEMRERL
JGI10216J12902_11781366013300000956SoilMARVVAAMAMTHSPGLTGWFTRASREYQELALQTTAEMR
Ga0066672_1006174943300005167SoilMAEIVAAMAMTHSPGLTGWFTRASREYQQLALQATAVMRRRLEAARP
Ga0070700_10177217513300005441Corn, Switchgrass And Miscanthus RhizosphereVAEIVAAMAMTHSPGLTGWFTRASQDYQQQALTALAEMRR
Ga0066686_1004860443300005446SoilVARVVAVMAMTHSPGLTGWFTRASREYQQLALQATAEMRR
Ga0066689_1069416713300005447SoilMAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRR
Ga0070706_10064592033300005467Corn, Switchgrass And Miscanthus RhizosphereMATIVSAMAMTHSPGLTGWFERASNDYQERALRAIGEMRERL
Ga0070706_10158957213300005467Corn, Switchgrass And Miscanthus RhizosphereMASIVCAMAMTHSPGLTGWFASASEEYQALALGALGEMRQRLHAARPDVI
Ga0073909_1014787213300005526Surface SoilVAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALGEMRRR
Ga0066905_10197414533300005713Tropical Forest SoilMSSIVAAMAMSHSPGLTGWFDRAPAEQQKEARRALTEL
Ga0068866_1030010213300005718Miscanthus RhizosphereMARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEMRERLA
Ga0066903_10852877313300005764Tropical Forest SoilMAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEM
Ga0066659_1113467133300006797SoilVAEIVAAMAMTHSPGLTGWFTRASEDYQRQALQATAEMR
Ga0066660_1055677413300006800SoilVARIVAAMAMTHSPGLTGWFTRAPEAYQRLALEAT
Ga0066660_1151428613300006800SoilMAEIVAAMAMTHSPGLTGWFSRASRDYQELALQATAEM
Ga0079220_1039987413300006806Agricultural SoilVAEVVTALAMTHSPGLTGWFTRASEEYQRLALQATAEM
Ga0075420_10141866633300006853Populus RhizosphereVATIVAAMAMTHSPGLTGWFERAPLQQQLLAKKAMDEMRWRLEA
Ga0075434_10015001753300006871Populus RhizosphereVAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRRLV
Ga0079219_1125268213300006954Agricultural SoilMAQAVAAMALTHSPGLTGWFDRAPEEFQQQALGATTEMRRRLEA
Ga0099793_1045557533300007258Vadose Zone SoilVAEIVAAMAMTHSPGLTGWFDRASEEHQQLALGATAEMRRRLEAA
Ga0099827_1165817413300009090Vadose Zone SoilMAEIVCAMAMTHSPGLTGWFASASAEYQALALGALGEMRQRL
Ga0105250_1009646013300009092Switchgrass RhizosphereMARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTE
Ga0105240_1017833753300009093Corn RhizosphereVAQVVAAMALTHSPGLTGWFDRAPENQRREARGALDTMRERL
Ga0105243_1246679233300009148Miscanthus RhizosphereMAQIVAAMAMTHSPGMTGWFTQAPEDQQELTLRATAALRERLDA
Ga0105241_1069261333300009174Corn RhizosphereMARIVAAMAMTHSPGLTGWFDRAPKSQQTQALQAMTEM
Ga0105075_102119413300009799Groundwater SandMARVVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMR
Ga0126306_1103157613300010166Serpentine SoilMAMTHSPGTTGWFDRAPQSHQTLALQAMTEMRERLA
Ga0126370_1125271113300010358Tropical Forest SoilMAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQATAEMRRRLVAA
Ga0126376_1200610513300010359Tropical Forest SoilMAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEMRERLAR
Ga0126379_1265819513300010366Tropical Forest SoilMARVVAAMAMTHSPGLTGWFDRAPMHQQLLAKKAMDEMRWRLEAAKPD
Ga0134127_1230051113300010399Terrestrial SoilVAEVVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLEA
Ga0137399_1168467013300012203Vadose Zone SoilMARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMR
Ga0137379_1167864913300012209Vadose Zone SoilMAKIVTAMAMTHSPGLTGWFDRAPMQQQLLAKKALDE
Ga0137370_1098504313300012285Vadose Zone SoilVSVADIVAAMAMTHSPGLTGWLDRAPEEFQQQALAATAEMR
Ga0137384_1021931243300012357Vadose Zone SoilVAKIVAAMAMTHSPGLTGWFDRAPKDQQAQALQAL
Ga0137385_1132463923300012359Vadose Zone SoilMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATA
Ga0137335_101432633300012670SoilVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQAT
Ga0137318_101956833300012671SoilMARIVAAMAMTHSPGLTGWFDRAPEDQRLEARRAPDEAREGLRGDRHGATLRWR
Ga0137394_1080109433300012922Vadose Zone SoilVATIVSAMAMTHSPGLTGWFERASTDYRERALRAIGEMRERLARSRP
Ga0137407_1040093943300012930Vadose Zone SoilVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLEA
Ga0134077_1029014233300012972Grasslands SoilMAEVVAAMAMTHSPGLTGWFDRASEEHQQLALGATASAS
Ga0163162_1113850933300013306Switchgrass RhizosphereMAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRERLAAAR
Ga0134075_1038083333300014154Grasslands SoilMAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATA
Ga0075354_111663413300014308Natural And Restored WetlandsVARIVTAMAMTHSPGLTGWFDRAPEDQRLAARRALDEMRE
Ga0075352_105276623300014324Natural And Restored WetlandsMSHVVAAMAMTHGPGLTGWFDRAPRAYQEMTLHATAEMRRRL
Ga0157380_1196452933300014326Switchgrass RhizosphereMAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRR
Ga0180094_103773033300014881SoilMARIVAAMAMTHSPGLTGWFDRAPEDQQIEARRALDEMRARRRAARPASSLRCG*
Ga0137409_1073516443300015245Vadose Zone SoilMARLVGAMAMTHSPGLTGWFTRASQEYQQLALQATA
Ga0182007_1015035113300015262RhizosphereVAQVVAAMALTHSPGLTGWFDRAPENQRREARGALDTMRE
Ga0134089_1004000413300015358Grasslands SoilMAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQATAEMRRR
Ga0132256_10010381163300015372Arabidopsis RhizosphereMAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRE
Ga0132256_10094736613300015372Arabidopsis RhizosphereMAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATAEMRRRLV
Ga0134112_1000648753300017656Grasslands SoilMARIVAAMAITHSPGLTGWFTRAPEAYQQLVLGATA
Ga0134083_1000681953300017659Grasslands SoilMARIVAAMAMTHSPGLTGWFTRAPEAYQQLVLGATA
Ga0163161_1090483013300017792Switchgrass RhizosphereMAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATLALSRIG
Ga0184609_1012740813300018076Groundwater SedimentMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEM
Ga0184612_1015167743300018078Groundwater SedimentVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRRRLE
Ga0184612_1016575713300018078Groundwater SedimentMAEIVAAMAMTHSPGLTGWFTRASESDQGLALQAT
Ga0184627_1014186713300018079Groundwater SedimentMATIVAALAMTHAPGLTGWFDRAPTEHQQEARRAL
Ga0184629_1030385013300018084Groundwater SedimentMARIVAAMAMTHSPGLTGWFDRAPQSHQTQSLQAM
Ga0187774_1088451333300018089Tropical PeatlandVAEVVAAMAMTHSPGLTGWFTRASEDYQQQALRATA
Ga0190270_1259814513300018469SoilMAQIVAAMAMTHSPGMTGWLTQAPKDQRELALRATAALRE
Ga0137408_114990213300019789Vadose Zone SoilMAEIVAAMAMTHSPGLTGWFSQASQDYQQQALHATA
Ga0193755_113236313300020004SoilVARIVAAMAMTHSPGLTGWFDRAPEDQQIEARRALDEMRERL
Ga0196964_1015083313300020202SoilMATIVAAMAMTHSPGLTGWFERAPMQQQLLARKAM
Ga0222623_1006309143300022694Groundwater SedimentVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATSEMRRRLEATRPD
Ga0209109_1023101113300025160SoilVARVVAAMAMTHAPGLTGWFDQAPEDQRVEARRAL
Ga0207684_1001446813300025910Corn, Switchgrass And Miscanthus RhizosphereMAEIVAAMAMTHSPGLTGWFARAPEEHQALARRAMD
Ga0207684_1155391723300025910Corn, Switchgrass And Miscanthus RhizosphereMASIVCAMAMTHSPGLTGWFASASEEYQALALGALGEMRQRL
Ga0207695_1056757033300025913Corn RhizosphereMALTHSPGLTGWFDRAPENQRREARGALDTMRERLRAA
Ga0207660_1151993613300025917Corn RhizosphereMAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQATA
Ga0207704_1046158243300025938Miscanthus RhizosphereMAEIVAAMAMTHSPGLTGWFSRASQEYQQLALQAT
Ga0207712_1195251913300025961Switchgrass RhizosphereVARIVAAMAMTHSPGLTGWFERAPEDQQVEARRALDEMRER
Ga0210090_102036933300025965Natural And Restored WetlandsVARIVTAMAMTHSPGLTGWFDRAPEDQRLAARRALDEMR
Ga0207640_1081985813300025981Corn RhizosphereVARIVAAMAMTHSPGLTGWFERAPEDQQVEARRALDEMRERLRAARPD
Ga0207708_1117908623300026075Corn, Switchgrass And Miscanthus RhizosphereVAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALAE
Ga0207675_10081500033300026118Switchgrass RhizosphereMAQIVAAMAMTHSPGMTGWFTQAPEDQQELTLRATAALRERLDAARP
Ga0257176_102746133300026361SoilMARIVAAMAMTHSPGLTGWFDRAPKDQQAQALQAL
Ga0257177_100768153300026480SoilMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRR
Ga0209875_104945323300027209Groundwater SandVAEIVAAMAMTHSPGLTGWFDRASEEYQQLALGATAEMRRRL
Ga0209968_104561113300027526Arabidopsis Thaliana RhizosphereVAEIVAAMAMTHSPGLTGWFDRASVEYQQLALSATAEMRPR
Ga0209588_121803333300027671Vadose Zone SoilMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRL
Ga0209074_1008204413300027787Agricultural SoilMALTHSPGLTGWFDRALENQRREARGALDTMRERLRAARPDVILLF
Ga0209465_1000928063300027874Tropical Forest SoilMARIVAAMAMTHSPGLTGWFDRAPKDYQEQALRALGEMRER
Ga0209382_1227684523300027909Populus RhizosphereMADIVAAMAMTHSPGLTGWFDRASEEYQQLALNATAEMR
Ga0209859_107117823300027954Groundwater SandMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRLEAAEQSREPR
Ga0268264_1258283513300028381Switchgrass RhizosphereMARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMRRRLEA
Ga0137415_1087737333300028536Vadose Zone SoilMAQIVAAMAMTHSPGLTGWFTRASQEYQQLALQAT
Ga0247824_1061552133300028809SoilVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQALVL
Ga0247825_1012262813300028812SoilMADIVAAMAMTHSPGLTGWFDRASEEYQQLALNATAEM
(restricted) Ga0255310_1001405813300031197Sandy SoilVAQLVAAMAMTHSPGLTGWFTRASQEYQQLALQAT
Ga0170824_10359638873300031231Forest SoilMAQIVAAMAMTHSPGLTGWFDRASKEYQEQALRAMTEMRERLAAARPPAR
Ga0318502_1002315713300031747SoilMAEIVAAMAMTHSPGLTGWFSRASGDHQRLALEATAEMRR
Ga0318521_1005755613300031770SoilMAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQATAEMR
Ga0318547_1015878913300031781SoilMAEIVAAMAMTHSPGLTGWFSRASEDYQRLALEATAEMRRRL
Ga0214473_1138185333300031949SoilVAEIVAAMAMTHSPGLTGWFTRASEEYQRLALQATAEMRQRLEA
Ga0318549_1013037813300032041SoilMAEIVAAMAMTHSPGLTGWFTRASQDYQQQALQAT
Ga0307470_1165561813300032174Hardwood Forest SoilMAEIVAAMAMTHSPGLTGWFDRAPKRHQEQALRAMGEMR
Ga0307471_10053837033300032180Hardwood Forest SoilMAMTHSPGLTGWFKSASEDYQALALGALGEMRQRLQAARPDVIV
Ga0307471_10312282913300032180Hardwood Forest SoilVAEIVAAMAMTHSPGLTGWFTRASEDYQHQALTALAEMRR
Ga0307471_10412782513300032180Hardwood Forest SoilMAKIVTAMAMTHSPGLTGWFDRAPMQQQLLAKKALDEM
Ga0307472_10081514313300032205Hardwood Forest SoilMAEIVAAMAMTHGPGLTGWFDAAPKEYQELTLRATDEMRRRL
Ga0316203_107534213300032274Microbial MatMAKIVAAMAMTHSPGLAGWFESAPAEEQQMALDAFSDM
Ga0326730_107406713300033500Peat SoilMAQIVAAMAMTHSPGLTGWFDRAPKDYQEQALRAMGEMRER
Ga0364924_150612_1_1443300033811SedimentMAQVVAAMAMTHSPGLTGWFTRASQEFQQLALQATAEMRRRLEAARPD
Ga0364941_022070_1159_13023300034417SedimentMARVVAAMAMTHSPGLTGWFTRASREYQELALQATAEMRRRLEAARPD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.