NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091660

Metagenome / Metatranscriptome Family F091660

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091660
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence PHGMPAYGGLLPPDAIWKLVTYLQSLEPPANVPTQSWR
Number of Associated Samples 89
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 88.79 %
% of genes from short scaffolds (< 2000 bps) 88.79 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.131 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(26.168 % of family members)
Environment Ontology (ENVO) Unclassified
(54.206 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.682 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.24%    β-sheet: 0.00%    Coil/Unstructured: 75.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07885Ion_trans_2 19.63
PF12710HAD 4.67
PF07722Peptidase_C26 3.74
PF14464Prok-JAB 2.80
PF01957NfeD 2.80
PF00106adh_short 1.87
PF07992Pyr_redox_2 1.87
PF04389Peptidase_M28 1.87
PF12704MacB_PCD 1.87
PF02687FtsX 1.87
PF07883Cupin_2 1.87
PF00072Response_reg 0.93
PF01145Band_7 0.93
PF10688Imp-YgjV 0.93
PF01243Putative_PNPOx 0.93
PF00486Trans_reg_C 0.93
PF13360PQQ_2 0.93
PF13419HAD_2 0.93
PF05694SBP56 0.93
PF00754F5_F8_type_C 0.93
PF00593TonB_dep_Rec 0.93
PF05157T2SSE_N 0.93
PF02126PTE 0.93
PF12833HTH_18 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1735Predicted metal-dependent hydrolase, phosphotriesterase familyGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.13 %
UnclassifiedrootN/A1.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002558|JGI25385J37094_10156524All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300002562|JGI25382J37095_10162975All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300002909|JGI25388J43891_1023496All Organisms → cellular organisms → Bacteria → Proteobacteria1059Open in IMG/M
3300002916|JGI25389J43894_1085158All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005166|Ga0066674_10163938All Organisms → cellular organisms → Bacteria → Proteobacteria1052Open in IMG/M
3300005172|Ga0066683_10566564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes692Open in IMG/M
3300005175|Ga0066673_10054534All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300005181|Ga0066678_10822414All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005187|Ga0066675_10644448All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300005187|Ga0066675_11056126All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis608Open in IMG/M
3300005187|Ga0066675_11412134All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium510Open in IMG/M
3300005366|Ga0070659_101408142All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005451|Ga0066681_10020003All Organisms → cellular organisms → Bacteria3418Open in IMG/M
3300005458|Ga0070681_10415770All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300005530|Ga0070679_101228670All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005536|Ga0070697_100095993All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300005559|Ga0066700_10732304All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005575|Ga0066702_10031183All Organisms → cellular organisms → Bacteria → Proteobacteria2729Open in IMG/M
3300005575|Ga0066702_10083696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1790Open in IMG/M
3300005586|Ga0066691_10156249All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300005586|Ga0066691_10879587All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis527Open in IMG/M
3300006797|Ga0066659_11465131All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006800|Ga0066660_10317401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1251Open in IMG/M
3300006806|Ga0079220_10524716All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300006854|Ga0075425_100586988All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300006903|Ga0075426_10206584All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300006903|Ga0075426_10372412All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300006914|Ga0075436_100903720All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium660Open in IMG/M
3300006914|Ga0075436_101190699All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300007258|Ga0099793_10090108All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300009012|Ga0066710_101156901All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1198Open in IMG/M
3300009088|Ga0099830_11428805All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300009093|Ga0105240_11484936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300009093|Ga0105240_12743527All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300009137|Ga0066709_100662507All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300009137|Ga0066709_101004210All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300009137|Ga0066709_103378351All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes580Open in IMG/M
3300009551|Ga0105238_10464483All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300010320|Ga0134109_10345361All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium583Open in IMG/M
3300010325|Ga0134064_10093054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium983Open in IMG/M
3300010335|Ga0134063_10762683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300010371|Ga0134125_10439003All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300010396|Ga0134126_10030173All Organisms → cellular organisms → Bacteria6868Open in IMG/M
3300010396|Ga0134126_11355238All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012038|Ga0137431_1091409All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300012204|Ga0137374_10464963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium990Open in IMG/M
3300012204|Ga0137374_10524215All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012209|Ga0137379_11696076All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes528Open in IMG/M
3300012211|Ga0137377_11489080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300012349|Ga0137387_10110658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1926Open in IMG/M
3300012351|Ga0137386_11237522All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium521Open in IMG/M
3300012360|Ga0137375_10405894All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300012362|Ga0137361_10718241All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300012389|Ga0134040_1164547All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300012396|Ga0134057_1097483All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012399|Ga0134061_1379958All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012676|Ga0137341_1047616All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012927|Ga0137416_11565907All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium599Open in IMG/M
3300012972|Ga0134077_10338726All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012975|Ga0134110_10460710All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012976|Ga0134076_10193132All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300014154|Ga0134075_10137007All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1044Open in IMG/M
3300014166|Ga0134079_10270894All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium742Open in IMG/M
3300015356|Ga0134073_10009815All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300018078|Ga0184612_10494142All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium599Open in IMG/M
3300018431|Ga0066655_10272230All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300018433|Ga0066667_10124372All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300018433|Ga0066667_10331472All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300018468|Ga0066662_10338173All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300019279|Ga0184642_1102578All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300020070|Ga0206356_10460413All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1083Open in IMG/M
3300020199|Ga0179592_10245957All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300021046|Ga0215015_10278031All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025911|Ga0207654_10286432All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1116Open in IMG/M
3300025912|Ga0207707_10580870All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300025913|Ga0207695_11626406Not Available527Open in IMG/M
3300025914|Ga0207671_10688976All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026142|Ga0207698_12194711All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300026297|Ga0209237_1140724All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300026297|Ga0209237_1184245All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes709Open in IMG/M
3300026298|Ga0209236_1060036All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300026310|Ga0209239_1006906All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6272Open in IMG/M
3300026310|Ga0209239_1059347All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1701Open in IMG/M
3300026310|Ga0209239_1227963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis649Open in IMG/M
3300026323|Ga0209472_1191349All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium715Open in IMG/M
3300026325|Ga0209152_10094408All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1119Open in IMG/M
3300026325|Ga0209152_10382157All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium547Open in IMG/M
3300026326|Ga0209801_1139085All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1031Open in IMG/M
3300026326|Ga0209801_1188909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae838Open in IMG/M
3300026331|Ga0209267_1257032All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300026334|Ga0209377_1000913All Organisms → cellular organisms → Bacteria19963Open in IMG/M
3300026342|Ga0209057_1066887All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300026527|Ga0209059_1263476All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium580Open in IMG/M
3300026530|Ga0209807_1046656All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300026547|Ga0209156_10401989All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300026548|Ga0209161_10043351All Organisms → cellular organisms → Bacteria2999Open in IMG/M
3300026550|Ga0209474_10657194All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300026552|Ga0209577_10654804All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300027765|Ga0209073_10176821All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300027846|Ga0209180_10047596All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300027846|Ga0209180_10062455All Organisms → cellular organisms → Bacteria2074Open in IMG/M
3300028536|Ga0137415_10971303All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes660Open in IMG/M
3300028784|Ga0307282_10480539All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031421|Ga0308194_10121091All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300031820|Ga0307473_10626527All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300032174|Ga0307470_10574040All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300033811|Ga0364924_099600Not Available659Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil26.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil16.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil11.21%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.80%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012676Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25385J37094_1015652423300002558Grasslands SoilQPHGMPAYGGLLPPDAIWKLVTYLQSLEPPADVPTQTWR*
JGI25382J37095_1016297513300002562Grasslands SoilFQSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK*
JGI25388J43891_102349613300002909Grasslands SoilIFQSIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPANVPTESWR*
JGI25389J43894_108515813300002916Grasslands SoilYYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWK*
Ga0066674_1016393823300005166SoilSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK*
Ga0066683_1056656413300005172SoilPRGMPAFGGILPPDAIWKLVTYLQSLQPAEDHATVSWSK*
Ga0066673_1005453423300005175SoilMSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPSADLPTEVWT*
Ga0066678_1082241413300005181SoilYGQPHGMPAYGGLLPPGAIWKVVTYLQSLEPPASVPTQSWK*
Ga0066675_1064444813300005187SoilEIFRSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK*
Ga0066675_1105612623300005187SoilIFYGRPRGMPAFGGILPPDAIWKVVTYLQYLQPAEDHATVSWSQ*
Ga0066675_1141213423300005187SoilSIHYGRPRGMPAFGGVLPPEAIWKLVTYLQSLAPAADLSTVAW*
Ga0070659_10140814213300005366Corn RhizosphereRRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK*
Ga0066681_1002000343300005451SoilFQSIYYGRPHGMPAYGGLLLAPEAVWKLVTYIQSLEPPADLPTEAWK*
Ga0070681_1041577033300005458Corn RhizosphereRRQGMPAFGGLMPAAGIWKVVTYLQSLEPPNDVPTESWK*
Ga0070679_10122867023300005530Corn RhizosphereGRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK*
Ga0070697_10009599313300005536Corn, Switchgrass And Miscanthus RhizosphereSDGEIFQSIYYGQAHGMPAYGGLLPPGAIWKLVTYLQSLAPPANVPTQSWK*
Ga0066700_1073230413300005559SoilPHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADLPTEAWDTSAR*
Ga0066702_1003118313300005575SoilMSNFGHPHGTPAYGGLLLAPDAVWKLVTDIQSLEPPADLPTEVWK*
Ga0066702_1008369633300005575SoilSIYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLEPAADLSTTSW*
Ga0066691_1015624913300005586SoilEIFQSIFYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK*
Ga0066691_1087958713300005586SoilGGGDGALFQSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR*
Ga0066659_1146513123300006797SoilAYGGLLLAPEAVWKLVTYIQSLEPPADLPTEAWR*
Ga0066660_1031740133300006800SoilMSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPSAGLPTEVWT*
Ga0079220_1052471613300006806Agricultural SoilYGRPHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADVPTEAWDTSGR*
Ga0075425_10058698813300006854Populus RhizosphereIFQSIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPADVPTESWR*
Ga0075426_1020658423300006903Populus RhizosphereYYGRRYGMPAFGGLMPKSGIWRIVTYLQSLPLPNDVPTESWK*
Ga0075426_1037241223300006903Populus RhizosphereGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPANVPTESWR*
Ga0075436_10090372023300006914Populus RhizosphereRPRGMPAFGGVLPPEAIWRLVTYLQSLTPAADPATVSW*
Ga0075436_10119069923300006914Populus RhizosphereMPAYGGVLPPAAIWKLVTYLQSLEPPANVPTQSWR*
Ga0099793_1009010813300007258Vadose Zone SoilYYGQAHGMPAYGGLLPAGTIWKVVTYLQLLEPPATVPTQSWK*
Ga0066710_10115690113300009012Grasslands SoilQSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR
Ga0099830_1142880513300009088Vadose Zone SoilHGMPAYGGLLLSPGAVWKLVTYLQALEPPEDVPTERWK*
Ga0105240_1148493623300009093Corn RhizosphereGMPAFGGLMPKAGIWRIVTYLQSLTLPNDVPTESWK*
Ga0105240_1274352713300009093Corn RhizosphereMPAFGGIMPAAGIWNVVTYLQSLEPPNDMPTEPWK*
Ga0066709_10066250713300009137Grasslands SoilADGEVFHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVTW*
Ga0066709_10100421013300009137Grasslands SoilRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDISTVSW*
Ga0066709_10337835123300009137Grasslands SoilFHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDNSTVSW*
Ga0105238_1046448313300009551Corn RhizosphereGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK*
Ga0134109_1034536123300010320Grasslands SoilYGRPRGMPAFGGVLPPDAIWKLVTYLQGLTPAVDPATVAW*
Ga0134064_1009305433300010325Grasslands SoilMSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPPADLPTEVWK*
Ga0134063_1076268313300010335Grasslands SoilIFYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK*
Ga0134125_1043900323300010371Terrestrial SoilMPAFGGIMPAAGIWKVVTYLQSLAPPNDVPTESWK*
Ga0134126_1003017313300010396Terrestrial SoilRRYGMPAFGGLMPKAGIWRIVTYLQSLTLPNDVPTESWK*
Ga0134126_1135523813300010396Terrestrial SoilSIYYGRRQGMPAFGGIMPAAGIWKVVTYLQSLAPPNDVPTESWK*
Ga0137431_109140913300012038SoilRPQGMPAFGGLLEPDVIWTLVTYIQSLPVPANVPTQSWVTP*
Ga0137374_1046496323300012204Vadose Zone SoilGMPAFGGILPPDAIWKLVTYLRTLQPATDEATVSWIR*
Ga0137374_1052421523300012204Vadose Zone SoilSIYLGRPRGMPAFGGILPPEAIWKLVTYLESLEPKHDNPTVAW*
Ga0137379_1169607623300012209Vadose Zone SoilMPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP*
Ga0137377_1148908013300012211Vadose Zone SoilSIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPADVPTESWR*
Ga0137387_1011065853300012349Vadose Zone SoilPRGMPAFGGILPPEAIWKLVTYLQSLQPAGDMSTTSWVRRP*
Ga0137386_1123752213300012351Vadose Zone SoilVIFQSIFSGRPRGMPAFGGILPPDAIWKLVTYLQSLQPTGDMSTTSWVRRR*
Ga0137375_1040589413300012360Vadose Zone SoilPHGMPAYGGLLPPGAIWKVVTYLQGLEPPANVPTQSWK*
Ga0137361_1071824113300012362Vadose Zone SoilMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQAWK*
Ga0134040_116454723300012389Grasslands SoilGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWH*
Ga0134057_109748323300012396Grasslands SoilRPRGMPAFGGILPPDAIWRLVTYLQSLEPKQDNSTVSW*
Ga0134061_137995813300012399Grasslands SoilRGMPAFGGVLPPEAIWKLVTYLQRLAPAADLSTESW*
Ga0137341_104761613300012676SoilGRPQGMPAFGGLLEPDVIWTLVTYIQSLPVPANVPTQSWVTP*
Ga0137416_1156590713300012927Vadose Zone SoilYGRPHGMPAYGGLLQTADAVWPLVTYLQSLTPPADVPTESWLPPPP*
Ga0134077_1033872633300012972Grasslands SoilHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVTW*
Ga0134110_1046071023300012975Grasslands SoilMSNFVHPHGMPAYGGLLLAPKAVWKLVTDIQSLEPSADLPTEVWT*
Ga0134076_1019313223300012976Grasslands SoilMPAYGGLLPPGAIWKLVTYLQSLEPPANVPTQSWR*
Ga0134075_1013700713300014154Grasslands SoilMPAYGGVLPPEAIWKVVTYLQSLAPREDVPTVSW*
Ga0134079_1027089423300014166Grasslands SoilSIYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLAPAVDPATVAW*
Ga0134073_1000981533300015356Grasslands SoilYYGQPHGMPAYGGMLPPTAIWKLVTYLQSLEPPANVPTESWR*
Ga0184612_1049414223300018078Groundwater SedimentPAFGGALPSDAIWMLVTYLQSLPVPAAVPTQSWEKP
Ga0066655_1027223013300018431Grasslands SoilDGAIFQSIYYGRPHGMPTYGGLLLAPEAVWKVVSYIQSLEPPADLPTEAWK
Ga0066667_1012437243300018433Grasslands SoilHGMPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP
Ga0066667_1033147233300018433Grasslands SoilYYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWK
Ga0066662_1033817313300018468Grasslands SoilVFHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVAW
Ga0184642_110257813300019279Groundwater SedimentSIYYGRPHGMPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP
Ga0206356_1046041323300020070Corn, Switchgrass And Miscanthus RhizosphereAAGEIFSSIYAGRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK
Ga0179592_1024595713300020199Vadose Zone SoilPHGMPAYGGLLPPDAIWKLVTYLQSLEPPANVPTQSWR
Ga0215015_1027803113300021046SoilPHGMPAYGGLLLSPGAVWRLVTYLQALEPPEDVPTERWK
Ga0207654_1028643213300025911Corn RhizosphereGRRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK
Ga0207707_1058087023300025912Corn RhizosphereMPAFGGIMPAAGIWNVVTYLQSLEPPNDMPTEPWK
Ga0207695_1162640613300025913Corn RhizosphereRRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK
Ga0207671_1068897613300025914Corn RhizosphereSAGEIFSSIYYGRRQGMPAFGGLMPAAGIWKVVTYLQSLEPPNDVPTESWK
Ga0207698_1219471123300026142Corn RhizosphereIFSSIYAGRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK
Ga0209237_114072423300026297Grasslands SoilPRGMPAFGGILPPDAIWKLATYLQSLEPKQDISTVSW
Ga0209237_118424513300026297Grasslands SoilMPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP
Ga0209236_106003633300026298Grasslands SoilHGMPAYGGLLPPGAIWKVVTYLQSLEPPANVPTQSWK
Ga0209239_100690623300026310Grasslands SoilMSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPPADLPTEVWK
Ga0209239_105934713300026310Grasslands SoilGGADGAIFQSIYYGRPRGMPAFGGLLPPDAIWKLVTYLQGLAPAVDPATVSW
Ga0209239_122796313300026310Grasslands SoilELFQSIYYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADVPTEAWQ
Ga0209472_119134923300026323SoilMSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPS
Ga0209152_1009440823300026325SoilYGRPRGMPAFGGLLPPDAIWKLVTYLQGLAPAVDPATASW
Ga0209152_1038215723300026325SoilRPRGMPAFGGVLPPDAIWRLVTYLQGLEPAADPSTTSW
Ga0209801_113908533300026326SoilDGALFQSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR
Ga0209801_118890933300026326SoilHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWR
Ga0209267_125703213300026331SoilPRGMPAFGGILPPEAIWKLVTYLHSLEPKQDISTVSW
Ga0209377_1000913143300026334SoilMPAFGGILSPDAIWKLVTYLQSLEPPADVPTERWP
Ga0209057_106688713300026342SoilPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK
Ga0209059_126347613300026527SoilIYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLEPAADPSTTSW
Ga0209807_104665613300026530SoilPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWH
Ga0209156_1040198913300026547SoilEIFRSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK
Ga0209161_1004335113300026548SoilMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK
Ga0209474_1065719423300026550SoilHSVYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLTPAVDPATVAW
Ga0209577_1065480423300026552SoilMSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPSAGLPTEVWT
Ga0209073_1017682113300027765Agricultural SoilYGRPHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADVPTEAWDTSGR
Ga0209180_1004759643300027846Vadose Zone SoilCYGQPHGMPAYGGLLPPDAIWKLVTYLQSLEPPADVPTQTWR
Ga0209180_1006245513300027846Vadose Zone SoilFESIYYGRPHGMPAYGGLLLSPGAVWKLVTYLQALEPPEDVPTERWK
Ga0137415_1097130313300028536Vadose Zone SoilYGRPHGMPAYGGLLQTADAVWPLVTYLQSLTPPADVPTESWLPPPP
Ga0307282_1048053923300028784SoilIYYGRPHGMPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP
Ga0308194_1012109113300031421SoilMPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP
Ga0307473_1062652723300031820Hardwood Forest SoilIFQSIYYGQAHGMPAYGGLLPPGAIWKLVTYLQSLAPPANVPTQSWK
Ga0307470_1057404033300032174Hardwood Forest SoilHGMPAYGGLLSSDVVWKLVTYLESLQPPPDLPTEAWDTSAR
Ga0364924_099600_1_1323300033811SedimentSISSGRPKGMPAFGGLLSPEIIWKLVTYLQSLPVPKSVPTQAW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.