NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091517

Metagenome Family F091517

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091517
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence MDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR
Number of Associated Samples 91
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.92 %
% of genes near scaffold ends (potentially truncated) 25.23 %
% of genes from short scaffolds (< 2000 bps) 79.44 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.196 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.888 % of family members)
Environment Ontology (ENVO) Unclassified
(27.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.402 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.10%    β-sheet: 0.00%    Coil/Unstructured: 58.90%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13419HAD_2 28.04
PF02548Pantoate_transf 8.41
PF13480Acetyltransf_6 7.48
PF01565FAD_binding_4 4.67
PF04127DFP 2.80
PF07690MFS_1 1.87
PF01345DUF11 0.93
PF03309Pan_kinase 0.93
PF02558ApbA 0.93
PF05977MFS_3 0.93
PF02678Pirin 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 8.41
COG0452Phosphopantothenoylcysteine synthetase/decarboxylase CoaBCCoenzyme transport and metabolism [H] 2.80
COG1521Pantothenate kinase type IIICoenzyme transport and metabolism [H] 0.93
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.93
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.20 %
UnclassifiedrootN/A2.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004156|Ga0062589_101157301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium737Open in IMG/M
3300004463|Ga0063356_100532337All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300004463|Ga0063356_104528936All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300004480|Ga0062592_101608588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium628Open in IMG/M
3300005093|Ga0062594_101778276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium648Open in IMG/M
3300005166|Ga0066674_10220671All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300005180|Ga0066685_10164036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1516Open in IMG/M
3300005187|Ga0066675_10074626All Organisms → cellular organisms → Bacteria2169Open in IMG/M
3300005294|Ga0065705_10781126All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005328|Ga0070676_10069921All Organisms → cellular organisms → Bacteria2104Open in IMG/M
3300005338|Ga0068868_100337874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1287Open in IMG/M
3300005444|Ga0070694_100946010All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300005446|Ga0066686_10004245All Organisms → cellular organisms → Bacteria6663Open in IMG/M
3300005451|Ga0066681_10273763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1028Open in IMG/M
3300005467|Ga0070706_100082331All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300005467|Ga0070706_101025562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium760Open in IMG/M
3300005468|Ga0070707_101766110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300005471|Ga0070698_100454514All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300005546|Ga0070696_100016277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii5003Open in IMG/M
3300005547|Ga0070693_100897844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium664Open in IMG/M
3300005557|Ga0066704_10641666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium677Open in IMG/M
3300006046|Ga0066652_101570123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300006049|Ga0075417_10023893All Organisms → cellular organisms → Bacteria2466Open in IMG/M
3300006049|Ga0075417_10067354All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300006049|Ga0075417_10107185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1272Open in IMG/M
3300006852|Ga0075433_10169204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1945Open in IMG/M
3300006876|Ga0079217_10044044All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300006894|Ga0079215_10470905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium771Open in IMG/M
3300006918|Ga0079216_10489470All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300007004|Ga0079218_10536425All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300007004|Ga0079218_12939678All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300009012|Ga0066710_101420486All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300009148|Ga0105243_10016212All Organisms → cellular organisms → Bacteria5639Open in IMG/M
3300009166|Ga0105100_10677517Not Available635Open in IMG/M
3300010301|Ga0134070_10467126All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010304|Ga0134088_10028370All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300010333|Ga0134080_10177086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium915Open in IMG/M
3300010400|Ga0134122_10105936All Organisms → cellular organisms → Bacteria2233Open in IMG/M
3300010400|Ga0134122_12602444All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012189|Ga0137388_10900479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium818Open in IMG/M
3300012204|Ga0137374_10086816All Organisms → cellular organisms → Bacteria3006Open in IMG/M
3300012206|Ga0137380_10489032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1085Open in IMG/M
3300012206|Ga0137380_11274262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium620Open in IMG/M
3300012207|Ga0137381_10249284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1543Open in IMG/M
3300012211|Ga0137377_10105193All Organisms → cellular organisms → Bacteria2677Open in IMG/M
3300012355|Ga0137369_10151623All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300012358|Ga0137368_10394037All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300012359|Ga0137385_10175651All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300012359|Ga0137385_10618289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium909Open in IMG/M
3300012360|Ga0137375_11293582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300012922|Ga0137394_10056340All Organisms → cellular organisms → Bacteria3253Open in IMG/M
3300012925|Ga0137419_10717180All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300012927|Ga0137416_10655938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium918Open in IMG/M
3300012927|Ga0137416_10920233Not Available778Open in IMG/M
3300012975|Ga0134110_10474480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300017657|Ga0134074_1393886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300018000|Ga0184604_10004373All Organisms → cellular organisms → Bacteria2512Open in IMG/M
3300018027|Ga0184605_10279057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium758Open in IMG/M
3300018028|Ga0184608_10000394All Organisms → cellular organisms → Bacteria11534Open in IMG/M
3300018028|Ga0184608_10366945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium630Open in IMG/M
3300018031|Ga0184634_10068351All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300018056|Ga0184623_10040168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2124Open in IMG/M
3300018056|Ga0184623_10226060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium858Open in IMG/M
3300018071|Ga0184618_10091329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1181Open in IMG/M
3300018071|Ga0184618_10284225All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300018074|Ga0184640_10048160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1754Open in IMG/M
3300018076|Ga0184609_10106743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1263Open in IMG/M
3300018078|Ga0184612_10438883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium651Open in IMG/M
3300018429|Ga0190272_12237180All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018431|Ga0066655_10092918All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300018468|Ga0066662_10156110All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300020003|Ga0193739_1003258All Organisms → cellular organisms → Bacteria4430Open in IMG/M
3300021080|Ga0210382_10158747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium971Open in IMG/M
3300022756|Ga0222622_10366925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1007Open in IMG/M
3300025885|Ga0207653_10000227All Organisms → cellular organisms → Bacteria37520Open in IMG/M
3300025885|Ga0207653_10032218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1695Open in IMG/M
3300025907|Ga0207645_10243867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1187Open in IMG/M
3300025910|Ga0207684_10680245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium875Open in IMG/M
3300025910|Ga0207684_11077242All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300025917|Ga0207660_10408445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1094Open in IMG/M
3300025918|Ga0207662_10091644All Organisms → cellular organisms → Bacteria1870Open in IMG/M
3300025921|Ga0207652_10390744All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300025922|Ga0207646_11448967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium596Open in IMG/M
3300025932|Ga0207690_11717518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300025961|Ga0207712_10655771All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300025981|Ga0207640_10911917All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300026089|Ga0207648_10089671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2686Open in IMG/M
3300026118|Ga0207675_100233313All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300026324|Ga0209470_1072890All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300026343|Ga0209159_1289798All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027471|Ga0209995_1065211Not Available621Open in IMG/M
3300027543|Ga0209999_1069660All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1674Open in IMG/M
3300027665|Ga0209983_1051987All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300027691|Ga0209485_1005641All Organisms → cellular organisms → Bacteria2556Open in IMG/M
3300027873|Ga0209814_10025111All Organisms → cellular organisms → Bacteria2435Open in IMG/M
3300027873|Ga0209814_10047330All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300027886|Ga0209486_10736750All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300028381|Ga0268264_10567906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1115Open in IMG/M
3300028536|Ga0137415_10241429All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300028536|Ga0137415_10418121All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300028715|Ga0307313_10103429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium866Open in IMG/M
3300028796|Ga0307287_10083584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1198Open in IMG/M
3300028807|Ga0307305_10033665All Organisms → cellular organisms → Bacteria2346Open in IMG/M
3300028875|Ga0307289_10190921All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300028881|Ga0307277_10002039All Organisms → cellular organisms → Bacteria7857Open in IMG/M
3300031965|Ga0326597_10998485All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300034178|Ga0364934_0066710All Organisms → cellular organisms → Bacteria1338Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment11.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062589_10115730113300004156SoilMDAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR*
Ga0063356_10053233723300004463Arabidopsis Thaliana RhizosphereMNADRKTPKEDAQDRARRSRRIHAFLIAWAERHWPERVTRFPKR*
Ga0063356_10452893613300004463Arabidopsis Thaliana RhizosphereMDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTRFAKR*
Ga0062592_10160858823300004480SoilMNEHKTPKDDAQSRARRSRRIHAFLTAWAARHWPERVTRFPKR*
Ga0062594_10177827623300005093SoilMDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTR
Ga0066674_1022067123300005166SoilMDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0066685_1016403633300005180SoilMNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVIR
Ga0066675_1007462613300005187SoilMDAKRKMPARDDGQARVRRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0065705_1078112613300005294Switchgrass RhizosphereMESQRKMPERDDRQARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0070676_1006992133300005328Miscanthus RhizosphereMDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR*
Ga0068868_10033787433300005338Miscanthus RhizosphereMDSQRKMSVRDDGQARARRSRRIHAFLTAWAQRHWPERVTRFPK
Ga0070694_10094601023300005444Corn, Switchgrass And Miscanthus RhizosphereMDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRFPKR*
Ga0066686_1000424533300005446SoilMNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR*
Ga0066681_1027376323300005451SoilMDAKTKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0070706_10008233133300005467Corn, Switchgrass And Miscanthus RhizosphereMTADRKMPASDDAAARARRSRRIHAFLRRWAERHMPERVTRFPRR*
Ga0070706_10102556223300005467Corn, Switchgrass And Miscanthus RhizosphereMTADRKMPASDDPAARARRSRRIRAFLRRWAERHMPERVT
Ga0070707_10176611023300005468Corn, Switchgrass And Miscanthus RhizosphereMDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVT
Ga0070698_10045451433300005471Corn, Switchgrass And Miscanthus RhizosphereMDAQRKTSARDDVQDRARRSHRIHAFLGAWAKRHWPERVTRFAKR*
Ga0070696_10001627773300005546Corn, Switchgrass And Miscanthus RhizosphereMDAKRKTAPSDDTRSRARRSRRIHAFLSAWAARHWPERVTRFTKR*
Ga0070693_10089784423300005547Corn, Switchgrass And Miscanthus RhizosphereMDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0066704_1064166623300005557SoilMNADRKTPTSDDAQARARRSRRIRAFLRRWADRHMPERVTRFPTR*
Ga0066652_10157012313300006046SoilMDAKTKMPARDDGQARARRSRRIHAFLSAWAQRHW
Ga0075417_1002389333300006049Populus RhizosphereMKDRKKPASETPESRARRSRRIHAFLDRWARRHMPERVTRFTSR*
Ga0075417_1006735423300006049Populus RhizosphereMDAKRKTLTSDDTRTRARRSRRIHTFLGAWAKRHWPERVTRFPKR*
Ga0075417_1010718523300006049Populus RhizosphereMAQPKMADAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR*
Ga0075433_1016920433300006852Populus RhizosphereMDAKRKTLTSDDTRTRARRSRRIHAFLGAWAKRHWPERVTRFPKR*
Ga0079217_1004404433300006876Agricultural SoilPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR*
Ga0079215_1047090513300006894Agricultural SoilMTAQRKMTDAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR*
Ga0079216_1048947023300006918Agricultural SoilMTAPRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR*
Ga0079218_1053642513300007004Agricultural SoilMTAQRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR*
Ga0079218_1293967823300007004Agricultural SoilMTAERKTVESKIEAARARRSIRIHAFLTRWAERHWPERVTRFPKR*
Ga0066710_10142048623300009012Grasslands SoilMNADRKQPAGDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR
Ga0105243_1001621263300009148Miscanthus RhizosphereMNAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR*
Ga0105100_1067751723300009166Freshwater SedimentMTAERKTVESKIEAARARRSIRIHAFLTRWADRHWPDRVTHFPKR*
Ga0134070_1046712623300010301Grasslands SoilMNADRKQPARDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR*
Ga0134088_1002837033300010304Grasslands SoilMNAERKTPASDEAQARARRSRRIHAFLRRWAERHMPERVTRFPTR*
Ga0134080_1017708623300010333Grasslands SoilMNAERKSPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR*
Ga0134122_1010593623300010400Terrestrial SoilMDAQHKMSERDDGQARARRSRRIQAFLSAWAQRHWPERVTRFRKR*
Ga0134122_1260244423300010400Terrestrial SoilSDMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR*
Ga0137388_1090047913300012189Vadose Zone SoilMTADRKMPASDDAAARARRSRQIHAFLHRWAKRHMPERVTRFPRR*
Ga0137374_1008681653300012204Vadose Zone SoilSDEKGGPQMNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR*
Ga0137380_1048903213300012206Vadose Zone SoilMNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPE
Ga0137380_1127426223300012206Vadose Zone SoilMNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVIRFPTR*
Ga0137381_1024928423300012207Vadose Zone SoilMNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR*
Ga0137377_1010519323300012211Vadose Zone SoilMDAKRKMPARDDGHARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0137369_1015162333300012355Vadose Zone SoilMNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR*
Ga0137368_1039403723300012358Vadose Zone SoilPQMNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR*
Ga0137385_1017565133300012359Vadose Zone SoilMNAERKTPASDDAQARARRSRLIHAFLRRWAERHMPERVIRFPTR*
Ga0137385_1061828913300012359Vadose Zone SoilMNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPERVTHFPTR*
Ga0137375_1129358213300012360Vadose Zone SoilMNADRKMRASDDAAARARRSRRIHAFLDGWAQRHWPDRVTHFGRR*
Ga0137394_1005634033300012922Vadose Zone SoilMNADRKKPARENEAARARRSRRIQAFLHRWALRHMPERVTRFSR*
Ga0137419_1071718023300012925Vadose Zone SoilYPMKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR*
Ga0137416_1065593823300012927Vadose Zone SoilMKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR*
Ga0137416_1092023313300012927Vadose Zone SoilEKGDLEMNAKRKMPARDDGPARARRSRRIHAFLSAWAQRHWPERVTRFPKR*
Ga0134110_1047448023300012975Grasslands SoilMDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPK
Ga0134074_139388613300017657Grasslands SoilMNADRKQPAGDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR
Ga0184604_1000437323300018000Groundwater SedimentMDSQRKKSERDDGQARARRSRRIHTFLSAWAQRHWPERVTRFAKR
Ga0184605_1027905713300018027Groundwater SedimentMDAQHKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR
Ga0184608_1000039483300018028Groundwater SedimentMDQRKTSVRDDGQARARRSRRIHIFLSAWAERHWPERVTRFPKR
Ga0184608_1036694513300018028Groundwater SedimentMDSKRKMSERDDGQARARRSRRIHTFLSAWAQRHWPERVTRFPKR
Ga0184634_1006835113300018031Groundwater SedimentMTAERKTPESKIEAARARRSIRIHAFLNRWARRHWPERVTRFPKR
Ga0184623_1004016833300018056Groundwater SedimentMTAERKTPNTKVEESRARRSIRIHAFLSRWAERHWPERVTRFPKR
Ga0184623_1022606023300018056Groundwater SedimentMTTQRKMTESTIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR
Ga0184618_1009132923300018071Groundwater SedimentMNADRKKPAREIEDARARRSRRIQAFLHRWALRHMPERVTRFSR
Ga0184618_1028422523300018071Groundwater SedimentMNADRKKLAKDDAEALARRSKRIHAFLGRWARRHMPARVTRFTR
Ga0184640_1004816023300018074Groundwater SedimentMNADRKTPESKIEAARARRSIRIHAFLNRWARRHWPERVTRFPKR
Ga0184609_1010674323300018076Groundwater SedimentMTERKTPDTKFEEARARRSIRIHAFLNRWAARHWPERVTRFPKR
Ga0184612_1043888323300018078Groundwater SedimentMTTQRKTPDTKFEEARARRSIRIHAFLSRWAARHWPERVTRFPKR
Ga0190272_1223718023300018429SoilMTDERKTPDAKFEEARARRSIRIHAFLNRWAARHWPERVTRFPKR
Ga0066655_1009291833300018431Grasslands SoilMDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR
Ga0066662_1015611023300018468Grasslands SoilMDAKRKMPARDDEQSRARRSRRIHAFLSAWAQRHWPERVTRFPKR
Ga0193739_100325853300020003SoilMTAERKTPDSKIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR
Ga0210382_1015874723300021080Groundwater SedimentMDAKRKTPTSDDTRTRLLRSRRIHAFLSAWAERHWPERVTRFPKR
Ga0222622_1036692523300022756Groundwater SedimentMDAKRKTPTSDDTRTRLLRSRRIHAFLSAWAERHWP
Ga0207653_10000227173300025885Corn, Switchgrass And Miscanthus RhizosphereMDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTRFAKR
Ga0207653_1003221823300025885Corn, Switchgrass And Miscanthus RhizosphereMDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR
Ga0207645_1024386723300025907Miscanthus RhizosphereMDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR
Ga0207684_1068024513300025910Corn, Switchgrass And Miscanthus RhizosphereMTADRKMPASDDAAARARRSRRIHAFLRRWAERHMPERVTRFPRR
Ga0207684_1107724223300025910Corn, Switchgrass And Miscanthus RhizosphereMDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRFPKR
Ga0207660_1040844523300025917Corn RhizosphereMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVT
Ga0207662_1009164423300025918Switchgrass RhizosphereMDAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR
Ga0207652_1039074413300025921Corn RhizosphereSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR
Ga0207646_1144896723300025922Corn, Switchgrass And Miscanthus RhizosphereMDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRF
Ga0207690_1171751813300025932Corn RhizosphereMDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRF
Ga0207712_1065577113300025961Switchgrass RhizosphereRKEVADMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR
Ga0207640_1091191723300025981Corn RhizosphereKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR
Ga0207648_1008967113300026089Miscanthus RhizosphereMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR
Ga0207675_10023331333300026118Switchgrass RhizosphereMDAQRNVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR
Ga0209470_107289033300026324SoilMNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR
Ga0209159_128979813300026343SoilAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR
Ga0209995_106521123300027471Arabidopsis Thaliana RhizosphereMTAERKTIESKIEEARARRSIRIHAFLTRWAEHHWPERVTRFTKR
Ga0209999_106966023300027543Arabidopsis Thaliana RhizosphereMTAERKTIESKIEEARARRSIRIHAFLTRWAERHWPERVTRFPKR
Ga0209983_105198723300027665Arabidopsis Thaliana RhizosphereMTAERKTVESKLEAARARRSIRIHAFLTRWAERHWPERVTRFPKR
Ga0209485_100564143300027691Agricultural SoilMTAQRKMTDAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR
Ga0209814_1002511123300027873Populus RhizosphereMAQPKMADAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR
Ga0209814_1004733033300027873Populus RhizosphereMDAKRKTLTSDDTRTRARRSRRIHTFLGAWAKRHWPERVTRFPKR
Ga0209486_1073675013300027886Agricultural SoilMTAQRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR
Ga0268264_1056790623300028381Switchgrass RhizosphereMDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPER
Ga0137415_1024142933300028536Vadose Zone SoilEKGDLEMNAKRKMPARDDGPARARRSRRIHAFLSAWAQRHWPERVTRFPKR
Ga0137415_1041812123300028536Vadose Zone SoilMKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR
Ga0307313_1010342923300028715SoilMNADRKKPARENEEARARRSRRIQAFLHRWALRHMPERVTRFSR
Ga0307287_1008358423300028796SoilMTTERKTPEKIEAARARRSIRIHAFLNRWAARHWPERVTRFPKR
Ga0307305_1003366513300028807SoilHKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR
Ga0307289_1019092123300028875SoilDAQHKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR
Ga0307277_1000203933300028881SoilMNADRKKPATENDAARARRSRRIQAFLHRWALRHMPERVTRFSR
Ga0326597_1099848523300031965SoilMTAQRKTTNARIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR
Ga0364934_0066710_992_11293300034178SedimentMTTQRKMMESTIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.