Basic Information | |
---|---|
Family ID | F091479 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 44 residues |
Representative Sequence | CVAQLRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGAL |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 98.13 % |
% of genes from short scaffolds (< 2000 bps) | 90.65 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.589 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.149 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.710 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.318 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 28.04 |
PF07690 | MFS_1 | 7.48 |
PF05977 | MFS_3 | 3.74 |
PF01557 | FAA_hydrolase | 2.80 |
PF13436 | Gly-zipper_OmpA | 2.80 |
PF04909 | Amidohydro_2 | 2.80 |
PF01425 | Amidase | 2.80 |
PF13458 | Peripla_BP_6 | 1.87 |
PF01408 | GFO_IDH_MocA | 1.87 |
PF08241 | Methyltransf_11 | 1.87 |
PF07355 | GRDB | 1.87 |
PF02894 | GFO_IDH_MocA_C | 1.87 |
PF01168 | Ala_racemase_N | 0.93 |
PF02775 | TPP_enzyme_C | 0.93 |
PF13532 | 2OG-FeII_Oxy_2 | 0.93 |
PF01180 | DHO_dh | 0.93 |
PF01799 | Fer2_2 | 0.93 |
PF01988 | VIT1 | 0.93 |
PF13442 | Cytochrome_CBB3 | 0.93 |
PF02639 | DUF188 | 0.93 |
PF02515 | CoA_transf_3 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 28.04 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 3.74 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.80 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.87 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.93 |
COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.93 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.93 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.93 |
COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 0.93 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.93 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.93 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.59 % |
Unclassified | root | N/A | 8.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_101373246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
3300000956|JGI10216J12902_100097070 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005289|Ga0065704_10616593 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005331|Ga0070670_100714055 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005406|Ga0070703_10531335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300005446|Ga0066686_10839321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 608 | Open in IMG/M |
3300005468|Ga0070707_100425467 | Not Available | 1288 | Open in IMG/M |
3300005546|Ga0070696_100070130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2465 | Open in IMG/M |
3300005552|Ga0066701_10500328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
3300005557|Ga0066704_10001888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 9421 | Open in IMG/M |
3300005713|Ga0066905_102159527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300005719|Ga0068861_100272830 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300005843|Ga0068860_100321372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1519 | Open in IMG/M |
3300005880|Ga0075298_1036656 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005886|Ga0075286_1067342 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300006880|Ga0075429_100666209 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300009038|Ga0099829_10494712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1015 | Open in IMG/M |
3300009078|Ga0105106_10405220 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300009088|Ga0099830_11770616 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009093|Ga0105240_11161974 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300009100|Ga0075418_10209230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2077 | Open in IMG/M |
3300009101|Ga0105247_11216151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
3300009147|Ga0114129_13094856 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300009171|Ga0105101_10581375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
3300009777|Ga0105164_10545488 | Not Available | 575 | Open in IMG/M |
3300010047|Ga0126382_10232499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300010047|Ga0126382_11168330 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010329|Ga0134111_10119387 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300010358|Ga0126370_10561113 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300010359|Ga0126376_10520047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1106 | Open in IMG/M |
3300010360|Ga0126372_11997316 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300010360|Ga0126372_12745422 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300010360|Ga0126372_13045754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300010361|Ga0126378_10991424 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300010371|Ga0134125_11054691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 890 | Open in IMG/M |
3300010397|Ga0134124_10002841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13983 | Open in IMG/M |
3300010397|Ga0134124_10516881 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300010400|Ga0134122_10801470 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300010403|Ga0134123_11650046 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300010403|Ga0134123_13091651 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010868|Ga0124844_1252385 | Not Available | 618 | Open in IMG/M |
3300011271|Ga0137393_10426730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1136 | Open in IMG/M |
3300011414|Ga0137442_1104256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
3300011441|Ga0137452_1176721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300012096|Ga0137389_10400975 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300012174|Ga0137338_1091491 | Not Available | 667 | Open in IMG/M |
3300012189|Ga0137388_10038920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3772 | Open in IMG/M |
3300012203|Ga0137399_10030157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3719 | Open in IMG/M |
3300012353|Ga0137367_10957128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
3300012361|Ga0137360_11385154 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300012361|Ga0137360_11642259 | Not Available | 548 | Open in IMG/M |
3300012922|Ga0137394_10663144 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300012929|Ga0137404_10739688 | Not Available | 891 | Open in IMG/M |
3300012931|Ga0153915_12222919 | Not Available | 642 | Open in IMG/M |
3300012951|Ga0164300_10621688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300012971|Ga0126369_11813029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 699 | Open in IMG/M |
3300012972|Ga0134077_10060010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1417 | Open in IMG/M |
3300014299|Ga0075303_1050701 | Not Available | 705 | Open in IMG/M |
3300014302|Ga0075310_1171022 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 505 | Open in IMG/M |
3300015264|Ga0137403_10001549 | All Organisms → cellular organisms → Bacteria | 28855 | Open in IMG/M |
3300015264|Ga0137403_10494953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
3300015359|Ga0134085_10186756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 889 | Open in IMG/M |
3300016294|Ga0182041_10969682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 767 | Open in IMG/M |
3300017997|Ga0184610_1263455 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300018031|Ga0184634_10424039 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018058|Ga0187766_10713093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 694 | Open in IMG/M |
3300018059|Ga0184615_10261452 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300018076|Ga0184609_10462750 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300018468|Ga0066662_10110051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1979 | Open in IMG/M |
3300018482|Ga0066669_10274831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
3300019997|Ga0193711_1012968 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300021073|Ga0210378_10342914 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300025549|Ga0210094_1035273 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300025900|Ga0207710_10586497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
3300025912|Ga0207707_11174071 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300025914|Ga0207671_11498646 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300025915|Ga0207693_10006110 | All Organisms → cellular organisms → Bacteria | 9981 | Open in IMG/M |
3300025917|Ga0207660_10451312 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300025922|Ga0207646_10527543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1063 | Open in IMG/M |
3300025972|Ga0207668_10663076 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300026035|Ga0207703_10320748 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300026075|Ga0207708_10093214 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
3300026088|Ga0207641_11962550 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300026118|Ga0207675_100347257 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300026307|Ga0209469_1118139 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300026377|Ga0257171_1106160 | Not Available | 500 | Open in IMG/M |
3300026499|Ga0257181_1006267 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300026507|Ga0257165_1012919 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1334 | Open in IMG/M |
3300026524|Ga0209690_1193585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
3300026552|Ga0209577_10289884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1223 | Open in IMG/M |
3300027252|Ga0209973_1053316 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300027646|Ga0209466_1085688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
3300027725|Ga0209178_1283932 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300028592|Ga0247822_10338992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → unclassified Modestobacter → Modestobacter sp. DSM 44400 | 1158 | Open in IMG/M |
3300028824|Ga0307310_10578404 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300028884|Ga0307308_10515377 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10133118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 678 | Open in IMG/M |
3300031544|Ga0318534_10130158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1448 | Open in IMG/M |
3300031716|Ga0310813_10006626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7259 | Open in IMG/M |
3300031763|Ga0318537_10285382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
3300031892|Ga0310893_10295685 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300031946|Ga0310910_10230921 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300032174|Ga0307470_11748675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300032180|Ga0307471_100871384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → unclassified Modestobacter → Modestobacter sp. | 1068 | Open in IMG/M |
3300032180|Ga0307471_103952385 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300034155|Ga0370498_171235 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300034820|Ga0373959_0080826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.74% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.87% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.93% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1013732461 | 3300000955 | Soil | RAMGAGARQFIITGFVPDPRAFMRRWSREVIPALG* |
JGI10216J12902_1000970702 | 3300000956 | Soil | DDCAAQIRRAMGAGARQFITTGFVPDPRGFMRRFMGDVAKLLS* |
Ga0065704_106165932 | 3300005289 | Switchgrass Rhizosphere | AGTPADCAAQLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL* |
Ga0070670_1007140552 | 3300005331 | Switchgrass Rhizosphere | TPDDCVAQIRRAMSAGARQFITTGFVPDPRGFMRRFMGEVANLLRGD* |
Ga0070703_105313351 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DDCAAQIRRAMGAGARQFITTGFVPDPRGFMRRFMGEVAHLLG* |
Ga0066686_108393211 | 3300005446 | Soil | DRFAVAGTPADCIAQLSRAMAAGARQFIITGFVPDPRAFMRRWSREVAPALA* |
Ga0070707_1004254671 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TPADCVAQVERAMDAGARQFLITGFVPDPRAFMRRWAREVADRVTV* |
Ga0070696_1000701303 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GTPADCVAQVVRAMGAGARQFLITGFVPDPRAFMRRWAKEVADRITV* |
Ga0066701_105003281 | 3300005552 | Soil | AQIRRAMAAGARQFVITSFVPDRRAFVRRWTREVAAAVV* |
Ga0066704_100018881 | 3300005557 | Soil | RAMAAGARQFIITAFVPDVRALMRRFMREVAAAVATPA* |
Ga0066905_1021595272 | 3300005713 | Tropical Forest Soil | IQRAMATGAHQFVITSFVPDPRAFMRRWSREIAAAVSG* |
Ga0068861_1002728301 | 3300005719 | Switchgrass Rhizosphere | QLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL* |
Ga0068860_1003213723 | 3300005843 | Switchgrass Rhizosphere | AVAGTPADCVAQLSRAMGAGARQFIITGFVPDPRAFMRRWSREVIPALG* |
Ga0075298_10366561 | 3300005880 | Rice Paddy Soil | ADCVAQVERAMAAGARQFLITGFVPDPRAFMRRWAKEVADRITV* |
Ga0075286_10673421 | 3300005886 | Rice Paddy Soil | DCVAQIARAMDAGARQFVITGFVPDPRTFMRRWAKEVAGAL* |
Ga0075429_1006662091 | 3300006880 | Populus Rhizosphere | AMAAGARQFITTSFVPDPRAFIRRWAQQVAMAVA* |
Ga0099829_104947121 | 3300009038 | Vadose Zone Soil | PDDCAAQIRRAMAAGARQFVITSFVPDPRAFMRRWAREVAAALG* |
Ga0105106_104052201 | 3300009078 | Freshwater Sediment | CVAQLRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGAL* |
Ga0099830_117706161 | 3300009088 | Vadose Zone Soil | RFAIAGTPSECVAQVRRAMAAGARQFIITGFVPDPPAFMRRWTREVADALP* |
Ga0105240_111619742 | 3300009093 | Corn Rhizosphere | GTPDDCVAQIRRAMDAGARQFMITGFVPDPGAFMRRWARDVAGRVAG* |
Ga0075418_102092303 | 3300009100 | Populus Rhizosphere | ADLRRAMAAGAHQFITTSFVPDPRVFMRRWRTEVAGVLTT* |
Ga0105247_112161512 | 3300009101 | Switchgrass Rhizosphere | RAMGAGARQFITTGFVPDPRGFMRRFMGEVAQSLS* |
Ga0114129_130948562 | 3300009147 | Populus Rhizosphere | AIAGTPADCVAQIRRAMAAGARQFVITGFVPDPRAFMKRWTHEVAAVL* |
Ga0105101_105813752 | 3300009171 | Freshwater Sediment | AELRRAMGAGSRQFMITGFVPDPRAFARRWMKEVAGAL* |
Ga0105164_105454882 | 3300009777 | Wastewater | AGTPEDCVAQISRAMAAGARQFMITGFVPDPRAFMRRWAREVVAAL* |
Ga0126382_102324991 | 3300010047 | Tropical Forest Soil | LVQIQRAMAAGAHQFVITGFVPDPSAFMRRWEREVAARL* |
Ga0126382_111683302 | 3300010047 | Tropical Forest Soil | IVGTPDECVAQIRRAMDAGARQFVITSFVPDPRAFVRRWSREVAAAVS* |
Ga0134111_101193871 | 3300010329 | Grasslands Soil | IRRAVAAGARQFVITSFVPDRRAFVRRWMREVAAAVR* |
Ga0126370_105611131 | 3300010358 | Tropical Forest Soil | RAMAAGAHQFVITGFVPDPSAFMRRWEREVAARL* |
Ga0126376_105200473 | 3300010359 | Tropical Forest Soil | AQIRRAMAAGAHQFVITGFVPDPSAFMRRWEREVAARL* |
Ga0126372_119973162 | 3300010360 | Tropical Forest Soil | VDRFAIAGTPGDCAAQIRRAMSAGARQFVITGIVPDPASFMRRFMREAAGAVRSRP* |
Ga0126372_127454221 | 3300010360 | Tropical Forest Soil | FGIAGTPEDCRAQISRAMAAGARQFMITGFVPDPRAFVRRWAREVATVRP* |
Ga0126372_130457541 | 3300010360 | Tropical Forest Soil | RRAMAAGAHQFVITSFVPDPRAFMRRWFREITAALGEPDLPPSR* |
Ga0126378_109914241 | 3300010361 | Tropical Forest Soil | FAIAGTPDNCVAQIRRAMDAGARQFVITSFVPDPHVFMRRWMRDVVANLS* |
Ga0134125_110546912 | 3300010371 | Terrestrial Soil | AMGAGARQFITTGFVPDPRGFMRRFMGEVARLLR* |
Ga0134124_100028411 | 3300010397 | Terrestrial Soil | FAIAGTPADCVAQVERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTA* |
Ga0134124_105168811 | 3300010397 | Terrestrial Soil | AMGAGARQFITTGFVPDPRGFMRRFMGEVAHLLG* |
Ga0134122_108014702 | 3300010400 | Terrestrial Soil | FAIAGTPADCVTQIRRAMAAGAQQFVITVFVPDPRAFMRRWSREVAAL* |
Ga0134123_116500461 | 3300010403 | Terrestrial Soil | RAMAAGARQFVITGFVPDGPAFMRRWAREVAGVV* |
Ga0134123_130916512 | 3300010403 | Terrestrial Soil | AIAGTPDECIAQIRRAMAAGARQFITTSFVPDPRAFMRRWAGEVAKAVT* |
Ga0124844_12523852 | 3300010868 | Tropical Forest Soil | CIAQISRAMAAGARQFILAGFVPDPRAFMRRWSREVAARI* |
Ga0137393_104267301 | 3300011271 | Vadose Zone Soil | AAQIRRAMAAGARQFVITSFVPDPRAFMRRWAREVAAALG* |
Ga0137442_11042561 | 3300011414 | Soil | IAGTPDDCAAQIRRAMGAGARQFITTGFVPDPRGFMRRFMGEVARLLS* |
Ga0137452_11767211 | 3300011441 | Soil | DDCAAQIRRAVGAGARQFITTGFVPDPRGFMRRFMGEVATSLS* |
Ga0137389_104009752 | 3300012096 | Vadose Zone Soil | LRDRFGIAGTSDDCVAQIRRAMAAGARQFIIAAFVPDVSGFMRRFMSEVAAAVGGPP* |
Ga0137338_10914911 | 3300012174 | Soil | AGTPDDCVVQISRAMAAGARQFMITGFVPDPRAFVRRWAREVVAALR* |
Ga0137388_100389206 | 3300012189 | Vadose Zone Soil | MAAGARQFIITAFVPDVSGFMRRFMSEVAAAVGGPR* |
Ga0137399_100301575 | 3300012203 | Vadose Zone Soil | RRAMAAGAHQFVITSFVPNPRAFMRRWMRDVVAAAR* |
Ga0137367_109571281 | 3300012353 | Vadose Zone Soil | DDCVAQVRRAMAAGARQFIVTSFVPDPRAFMRRFMGEVAAAVGDAR* |
Ga0137360_113851541 | 3300012361 | Vadose Zone Soil | TPAECAAQIRRAMAAGAQQFITTSFVPDPRAFMRRWAKEVAAGLA* |
Ga0137360_116422591 | 3300012361 | Vadose Zone Soil | DCVAQVERAMDAGARQFLITGFVPDPRAFMRRWAREVADRVTV* |
Ga0137394_106631442 | 3300012922 | Vadose Zone Soil | DRFAIAGTPADCVAQIRRAMAAGARQFVITGFVPDPRAFMRRWAHEVAGVV* |
Ga0137404_107396881 | 3300012929 | Vadose Zone Soil | PPDCVAQLSRAMAAGARQFIITAFVPDPRAFMRRWAKEVVPALG* |
Ga0153915_122229192 | 3300012931 | Freshwater Wetlands | CVAQISRAMAAGARQFMITGFVPDPRAFMRRWAREVVAALR* |
Ga0164300_106216881 | 3300012951 | Soil | IAGTPADCVAQVERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTV* |
Ga0126369_118130291 | 3300012971 | Tropical Forest Soil | QRAMAAGARQFIITGFVPDPSAFMRRWAREVAGRL* |
Ga0134077_100600103 | 3300012972 | Grasslands Soil | FAVAGTPADCIAQLSRAMAAGARQFIITGFVPDPRAFMRRWSREVAPALA* |
Ga0075303_10507012 | 3300014299 | Natural And Restored Wetlands | RDCVAQLSRAMAAGARQFIITGFVPDPRAFMRQWAREVAPALV* |
Ga0075310_11710222 | 3300014302 | Natural And Restored Wetlands | FLVDRFAIAGTPGECVAQIRRAMEAGARQFITTSFVPEPGLFMRRWAGEVAGPLG* |
Ga0137403_100015491 | 3300015264 | Vadose Zone Soil | DCVAQLSRAMAAGARQFIITAFVPDPRAFMRRWAKEVVPALG* |
Ga0137403_104949531 | 3300015264 | Vadose Zone Soil | DCVAQLSRAMAAGARQFIITAFVPDPRAFMRRWSREVVSALG* |
Ga0134085_101867562 | 3300015359 | Grasslands Soil | SDDCVAQVRRAMAAGARQFIITAFVPDVRALMRRFMREVAAAVGTPA* |
Ga0182041_109696821 | 3300016294 | Soil | IAQIQRAMAAGARQFIITGFVPDPSAFMRRWAREVAARL |
Ga0184610_12634552 | 3300017997 | Groundwater Sediment | IAGTPADCVAQLRRAIAAGARQFITTSFVPDPRAFMRRWAREVAQPLA |
Ga0184634_104240392 | 3300018031 | Groundwater Sediment | AGTPADCVAQLRRAMGAGARQFMITGFVPDPPAFMRRWMKEVAGVL |
Ga0187766_107130932 | 3300018058 | Tropical Peatland | RFAVAGTASDCVAQLSRAMAAGARQFIITSFVPDPRLFVRRWAREVVPAL |
Ga0184615_102614521 | 3300018059 | Groundwater Sediment | VAQIRRAIAAGARQFITTSFVPDPRAFMRRWAREVADTLG |
Ga0184609_104627502 | 3300018076 | Groundwater Sediment | ADCVAQLRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGVL |
Ga0066662_101100511 | 3300018468 | Grasslands Soil | CVAQVRRAMAAGARQFIITAFVPDVRALMRRFMREVAAAVATPA |
Ga0066669_102748313 | 3300018482 | Grasslands Soil | AQIQRAVAAGARQFVITSFVPDRRAFVRRWMREVAAAVR |
Ga0193711_10129682 | 3300019997 | Soil | VAQLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL |
Ga0210378_103429141 | 3300021073 | Groundwater Sediment | HRQRFAIAGTPADCVAQLRRAIAAGARQFITTSFVPDPRAFMRRWAREVAQPLA |
Ga0210094_10352732 | 3300025549 | Natural And Restored Wetlands | QLRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGAL |
Ga0207710_105864972 | 3300025900 | Switchgrass Rhizosphere | RAMGAGARQFITTGFVPDPRGFMRRFMGEVAQSLS |
Ga0207707_111740711 | 3300025912 | Corn Rhizosphere | RRAMAAGARQFITTSFVPDPRAFMRRWAGEVAKAVT |
Ga0207671_114986462 | 3300025914 | Corn Rhizosphere | CVAQVERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTA |
Ga0207693_100061101 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAGTPADCVAQLSRAMGAGARQFIITGFVPDPRAFMRRWSREVIPALG |
Ga0207660_104513121 | 3300025917 | Corn Rhizosphere | RFAVAGTPADCAAQLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL |
Ga0207646_105275431 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGAL |
Ga0207668_106630761 | 3300025972 | Switchgrass Rhizosphere | RRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL |
Ga0207703_103207483 | 3300026035 | Switchgrass Rhizosphere | GTPDDCAAQIRRAMGAGARQFITTGFVPDPRGFMRRFMGEVAQSLS |
Ga0207708_100932144 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QIRRAMSAGARQFITTGFVPDPRGFMRRFMGEVANLLRGD |
Ga0207641_119625501 | 3300026088 | Switchgrass Rhizosphere | AIAGTPADCVEQIRRAMAAGARQFVITGFVPEGPAFMRRWAREVAGVV |
Ga0207675_1003472573 | 3300026118 | Switchgrass Rhizosphere | QLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL |
Ga0209469_11181392 | 3300026307 | Soil | VAQIRRAVAAGARQFVITSFVPDRRAFVRRWMREVAAAVR |
Ga0257171_11061601 | 3300026377 | Soil | RAMAAGARQFIITAFVPDPRAFMRRWAKEVVPALG |
Ga0257181_10062671 | 3300026499 | Soil | LVDRFAVAGTPADCVAQLRRAMGAGARQFMITGFVPDPRAFMRRWMKEVAGVL |
Ga0257165_10129191 | 3300026507 | Soil | DCVAQVERAMDAGARQFLITGFVPDPRAFMRRWAREVADRVTV |
Ga0209690_11935851 | 3300026524 | Soil | AQIRRAMAAGARQFVITSFVPDRRAFVRRWTREVAAAVV |
Ga0209577_102898841 | 3300026552 | Soil | DCVAQVRRAMAAGARQFIITAFVPDVRALMRRFMREVAAAVGTPA |
Ga0209973_10533161 | 3300027252 | Arabidopsis Thaliana Rhizosphere | QIRRAMDAGARQFMITGFVPDPGAFMRRWARDVAGRVAG |
Ga0209466_10856881 | 3300027646 | Tropical Forest Soil | DRFAIGGTPDECVAQVRRAVAAGAHQFVIAGFVADSRAFMRRFMREVAAPCGSGA |
Ga0209178_12839322 | 3300027725 | Agricultural Soil | AIAGTPADCVAQVERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTV |
Ga0247822_103389923 | 3300028592 | Soil | VGGRAGDCVAQIRRAMAAGARQFVITGFVPDPRAFMKRWTHEVAAVL |
Ga0307310_105784042 | 3300028824 | Soil | DRFAVAGTPADCVAQLRRAMGAGARQFMITGFVPDPGAFMRRWMKEVAGAL |
Ga0307308_105153771 | 3300028884 | Soil | ADRFAVAGTPADCVAQLRRAVGAGARQFMITGFVPDPGAFMRRWMKEVAGAL |
(restricted) Ga0255310_101331181 | 3300031197 | Sandy Soil | RAMAAGARQFIITAFVPDVRALMRRFMREVAAAVGSPR |
Ga0318534_101301582 | 3300031544 | Soil | FLVDRFAVAGTASDCVAQLSRAMAAGARQFIITSFVPDPRLFMRRWAREVVPAL |
Ga0310813_100066267 | 3300031716 | Soil | DCVAQVERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTA |
Ga0318537_102853821 | 3300031763 | Soil | SDCVAQLSRAMAAGARQFIITSFVPDPRLFMRRWAREVVPAL |
Ga0310893_102956851 | 3300031892 | Soil | IAGTPGECVTQIRRAMTAGARQFITTSFVPDPRVFMRRWAGGVADALT |
Ga0310910_102309211 | 3300031946 | Soil | GDCLAQIRRAMAAGAHQFVITGFVPDPSAFMRRWEREVAARL |
Ga0307470_117486752 | 3300032174 | Hardwood Forest Soil | MGAGARQFITTGFVPDPRGFMRRFMGEVAKSSSSTES |
Ga0307471_1008713843 | 3300032180 | Hardwood Forest Soil | GTPADCVAQIRRAMAAGARQFIITGFVPDPSAFMRQWAGEVAGVV |
Ga0307471_1039523851 | 3300032180 | Hardwood Forest Soil | PADCVTQIRRAMAAGARQFVITGFVPDPRVFMRRWASEVAAVV |
Ga0370498_171235_1_150 | 3300034155 | Untreated Peat Soil | FAVAGTPADCVAQLRRAMGAGARQFMITGFVPDPRAFVRRWMKEVAGAL |
Ga0373959_0080826_630_746 | 3300034820 | Rhizosphere Soil | VERAVEAGARQFLITGFVPDPRAFVRRWMREVAGRVTV |
⦗Top⦘ |