NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091042

Metagenome / Metatranscriptome Family F091042

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091042
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 46 residues
Representative Sequence MTLWAMRAAVLGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNEQMTLFK
Number of Associated Samples 99
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 87.96 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.444 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(6.481 % of family members)
Environment Ontology (ENVO) Unclassified
(35.185 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.704 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.44%    β-sheet: 0.00%    Coil/Unstructured: 52.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF01609DDE_Tnp_1 81.48
PF09699Paired_CXXCH_1 0.93
PF00756Esterase 0.93
PF12543DUF3738 0.93
PF13180PDZ_2 0.93
PF00665rve 0.93
PF13193AMP-binding_C 0.93
PF14403CP_ATPgrasp_2 0.93
PF12762DDE_Tnp_IS1595 0.93
PF00753Lactamase_B 0.93
PF08545ACP_syn_III 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 81.48
COG3293TransposaseMobilome: prophages, transposons [X] 81.48
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 81.48
COG5421TransposaseMobilome: prophages, transposons [X] 81.48
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 81.48
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 81.48
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.93
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.93
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.93
COG4584TransposaseMobilome: prophages, transposons [X] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.44 %
UnclassifiedrootN/A5.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_101326_len_1424_cov_8_616573All Organisms → cellular organisms → Bacteria1474Open in IMG/M
2124908035|B3_GZOS_CLC_ConsensusfromContig79074Not Available794Open in IMG/M
2140918008|ConsensusfromContig366581All Organisms → cellular organisms → Bacteria614Open in IMG/M
2170459003|FZ032L002FVI26All Organisms → cellular organisms → Bacteria545Open in IMG/M
2170459005|F1BAP7Q02GN6Q9All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300000318|WSSedL1CaDRAFT_10016273All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105110022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3709Open in IMG/M
3300000789|JGI1027J11758_12633136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3576Open in IMG/M
3300000955|JGI1027J12803_102042619All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3532Open in IMG/M
3300001402|JGI20195J14853_1045768All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300002245|JGIcombinedJ26739_100814160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola814Open in IMG/M
3300002914|JGI25617J43924_10064867All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300003505|JGIcombinedJ51221_10321582All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300004092|Ga0062389_101052266All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300005332|Ga0066388_103789769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3771Open in IMG/M
3300005555|Ga0066692_10136364All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300005591|Ga0070761_10136720All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300005610|Ga0070763_10080306All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300005610|Ga0070763_10941148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3515Open in IMG/M
3300005764|Ga0066903_100307074All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300005764|Ga0066903_101428871All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300005952|Ga0080026_10167052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3642Open in IMG/M
3300005994|Ga0066789_10079744All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300006050|Ga0075028_100096750All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006055|Ga0097691_1098060All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300006059|Ga0075017_100317991All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300006102|Ga0075015_100500083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3700Open in IMG/M
3300006642|Ga0075521_10064618All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300006642|Ga0075521_10083874All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300006796|Ga0066665_11467098Not Available531Open in IMG/M
3300007819|Ga0104322_133420All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300009623|Ga0116133_1017461All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300009623|Ga0116133_1029459All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300009628|Ga0116125_1124201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3703Open in IMG/M
3300009639|Ga0116122_1273401Not Available521Open in IMG/M
3300009646|Ga0116132_1201256All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300009662|Ga0105856_1304011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3534Open in IMG/M
3300009792|Ga0126374_10506960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3871Open in IMG/M
3300010376|Ga0126381_100978869All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300012199|Ga0137383_10030499All Organisms → cellular organisms → Bacteria3782Open in IMG/M
3300012285|Ga0137370_10165694All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300012357|Ga0137384_10980490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3680Open in IMG/M
3300012929|Ga0137404_11714114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3584Open in IMG/M
3300012958|Ga0164299_11686650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3502Open in IMG/M
3300014160|Ga0181517_10067577All Organisms → cellular organisms → Bacteria2146Open in IMG/M
3300014160|Ga0181517_10148422All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300014169|Ga0181531_10084081All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300014498|Ga0182019_10205069All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300014498|Ga0182019_10849659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3655Open in IMG/M
3300014657|Ga0181522_10635389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3649Open in IMG/M
3300014838|Ga0182030_10896966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3795Open in IMG/M
3300016319|Ga0182033_11821297All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300017946|Ga0187879_10124859All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300017948|Ga0187847_10076005All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300017959|Ga0187779_10365295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3935Open in IMG/M
3300017988|Ga0181520_10260711All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300017999|Ga0187767_10074785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3893Open in IMG/M
3300018030|Ga0187869_10373218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3681Open in IMG/M
3300018088|Ga0187771_10130482All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300019258|Ga0181504_1389383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3664Open in IMG/M
3300019270|Ga0181512_1579304All Organisms → cellular organisms → Bacteria2335Open in IMG/M
3300019785|Ga0182022_1211708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2449Open in IMG/M
3300020057|Ga0163151_10515819All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300021180|Ga0210396_10450153All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300021384|Ga0213876_10678888All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021401|Ga0210393_10182627All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300021474|Ga0210390_11180979All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300021476|Ga0187846_10091095All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300021476|Ga0187846_10171964All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300022520|Ga0224538_1005142All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300023075|Ga0224520_1007951All Organisms → cellular organisms → Bacteria2758Open in IMG/M
3300023088|Ga0224555_1043495All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300025412|Ga0208194_1077463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3505Open in IMG/M
3300025604|Ga0207930_1136874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3534Open in IMG/M
3300025857|Ga0209014_10069947All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300025857|Ga0209014_10094720All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300026215|Ga0209849_1011135All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300026291|Ga0209890_10057070All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300026310|Ga0209239_1313292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3544Open in IMG/M
3300026490|Ga0257153_1012301All Organisms → cellular organisms → Bacteria1717Open in IMG/M
(restricted) 3300027799|Ga0233416_10146678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3809Open in IMG/M
3300027853|Ga0209274_10103957All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300027875|Ga0209283_10542541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3744Open in IMG/M
3300027894|Ga0209068_10131592All Organisms → cellular organisms → Bacteria1342Open in IMG/M
(restricted) 3300027995|Ga0233418_10043450All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300028069|Ga0255358_1010062All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300028740|Ga0302294_10140417All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300028748|Ga0302156_10164520All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300028780|Ga0302225_10118630All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300029992|Ga0302276_10326348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3655Open in IMG/M
3300031234|Ga0302325_11872236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3748Open in IMG/M
3300031525|Ga0302326_12425240Not Available661Open in IMG/M
3300031595|Ga0265313_10173881All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300031680|Ga0318574_10644990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales621Open in IMG/M
3300031788|Ga0302319_10495368All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300031799|Ga0318565_10521424All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031896|Ga0318551_10583811All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031996|Ga0308176_11172815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3814Open in IMG/M
3300032256|Ga0315271_10516456All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300032782|Ga0335082_10255046All Organisms → cellular organisms → Bacteria → Proteobacteria1636Open in IMG/M
3300033402|Ga0326728_10268757All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300033405|Ga0326727_10069751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5094Open in IMG/M
3300033887|Ga0334790_021344All Organisms → cellular organisms → Bacteria2905Open in IMG/M
3300033977|Ga0314861_0094724All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300034169|Ga0370480_0144932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3813Open in IMG/M
3300034349|Ga0370504_0005083All Organisms → cellular organisms → Bacteria2996Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil6.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.63%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.70%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.78%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.78%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.85%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.85%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.85%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.85%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.93%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.93%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908035Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000318Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 CattailEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001402Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300022520Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M
3300034349Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_012039102124908028SoilMTLWAMRAAVLGKGPWLLIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK
B3_GZOS_CLC_017014902124908035SoilMTLWAMRAAVLGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLDEQMTLFK
Bog_all_C_037190202140918008SoilMTLWAMRAAVLGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNEQMTLFK
E4A_102610302170459003Grass SoilMTLWALRGAILGKGPWLLIHSEKHLYRLRNTPRKRNLTS
E41_080416402170459005Grass SoilMTLWAMRAAILGKGPWLLIRNENNLDRLRNSRRKRRLVTHDLNAQLTLFK
WSSedL1CaDRAFT_1001627323300000318WetlandLRGAIISIGIWLLIQSEENLDRLRNSLRKRGLDSDNLARSALEFPDVIF*
INPhiseqgaiiFebDRAFT_10511002223300000364SoilMTLWAMRGAVLGKGPWLLIRNDXNLDRLRNSSXKRRLVTHDLNEQMTLFK*
JGI1027J11758_1263313623300000789SoilMTLWAMRGAVLGKGPWLLIRNDGNLDRLRNSSRKRRLVTHDLNEQMTLFK*
JGI1027J12803_10204261913300000955SoilMRGAVLGKGPWLLIRNDGNLDRLRNSSRKRRLVTHDLNEQMTL
JGI20195J14853_104576823300001402Arctic Peat SoilMRAAVLGKGPWLLIRNEKNLDRLRNSPRKRRLVTHDLNE
JGIcombinedJ26739_10081416013300002245Forest SoilGPWLLIRNDNNLDRLRNSSRKRRLVTHDLNKQMTLFR*
JGI25617J43924_1006486723300002914Grasslands SoilMTLWAMRGAVLGKGPWLLIRSDENLNRLRNSPRKRRLVTHDLNEQLTLFR*
JGIcombinedJ51221_1032158223300003505Forest SoilMTLWAMRGAILGKGPWLLIRNEENLNRLRNSPRKRRLATHDLNEQMTLL*
Ga0062389_10105226623300004092Bog Forest SoilMTLWAMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNQQMTLFR*
Ga0066388_10378976913300005332Tropical Forest SoilMALWAIRGAVLAKGPWLLIRNSDYLDRLRNSPRKRRLISHDLNQQMTLFK*
Ga0066692_1013636413300005555SoilMRGAVLGKGPWLLIRDDENLDRLRNSPRKRRLVSHDVNEQMTLFK*
Ga0070761_1013672023300005591SoilMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNQQMTLFR*
Ga0070763_1008030633300005610SoilMTLWAMRSAVLGKGPWLLIRNEENLDRLRNSPRKRRLTTHDLN
Ga0070763_1094114823300005610SoilMTLWALRGAVVGRGAWLLIRSAKNLDRLRNSSRSRLQA
Ga0066903_10030707433300005764Tropical Forest SoilMALWAMRGAVLGKGPWLLIRNQDNLNRLCNSRRKRRLVSHDLNEQMPLFM*
Ga0066903_10142887123300005764Tropical Forest SoilMTLWAMRGAVLGKGPWLLIRDNDHLDRLRNSPRNRRLTSHDLNQQMILFMQ*
Ga0080026_1016705223300005952Permafrost SoilMTLWAMRSAVLGKGPWLLIRNEENLDRLRNSPRKRGIVTHYLNEQMLLFK*
Ga0066789_1007974423300005994SoilMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDLNEQMTLFR*
Ga0075028_10009675013300006050WatershedsMTLWALRGAILGKGPWLLIHSEKHLDRLRNTPRKRNLTSHELGEGIQEMSQL
Ga0097691_109806013300006055Arctic Peat SoilMRAAVLGKGPWLLIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK*
Ga0075017_10031799113300006059WatershedsMTLWALRAAVLGKGPWLLIRNDENLDRLCNSPRKRRLVSHDLNEQMTLFK*
Ga0075015_10050008323300006102WatershedsMALWAMRGAVLGKGPWLLIRDDENLDRLRNSPRKRRLVTHDLNE
Ga0075521_1006461823300006642Arctic Peat SoilMTLWAMRAAVLGKGPWLLIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK*
Ga0075521_1008387413300006642Arctic Peat SoilMTLWAMRAAVLGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNEQMTLFK*
Ga0066665_1146709813300006796SoilPWLLIRENKNLDLLRNSSRKRRLVSHDLYEQMTLFK*
Ga0104322_13342013300007819Permafrost SoilMTLWAMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDLNEQMTLFK*
Ga0116133_101746113300009623PeatlandMTLWAMRAAILGKGPWLLIRNENNLDRLRNSPRKRRLVTHDLNAQLTLFK*
Ga0116133_102945913300009623PeatlandMTLWAMRGAVLGKGPWLLIRNEENLDRLRNSPRKRGIVTHYLNEQMPLFK*
Ga0116125_112420113300009628PeatlandMTLWAMRGAVLGKGPWLLIRNEQNLDRLRNSPRKR
Ga0116122_127340113300009639PeatlandSRFRMTLWAMRGAVLGKGPWLLIRNEENLDRLRNSPRKRRLTTHDLNQQLTLFK*
Ga0116132_120125623300009646PeatlandMTLWAMRGAVLGKGPWLLIRNEENLDRLRNSPRKRGIVT
Ga0105856_130401113300009662Permafrost SoilMTLWAMRGAILGKGPWLLIRNDENLNRLRNSPRKRRLTTQKLNEQMSLL*
Ga0126374_1050696013300009792Tropical Forest SoilMTLWAMRGAVLGKGPWLLIRDNDHLDRLRNSPRNRRLTRHDLNQQMILFMQ*
Ga0126381_10097886913300010376Tropical Forest SoilMTLWAMRGAVLGKGPWLLIRDNDHLDRLRNSPRNRRLT
Ga0126381_10227594323300010376Tropical Forest SoilLIRDNDHLDRLRNSPRNRRLTSHDLNQQMILFMQ*
Ga0137383_1003049923300012199Vadose Zone SoilMTLWAIRGAVLGKGPWLLIRNNENLDRLRNSPRKRRLASHDLSQHQQMTLFK*
Ga0137370_1016569423300012285Vadose Zone SoilMTLWALRVAVLGDGPWLVIRSEKNLDRLRNTSRKRDLTSDTLS
Ga0137384_1098049013300012357Vadose Zone SoilMTLWALRGAVLGRGAWLLIRDEQNLDRLRNSSRARVQ
Ga0137404_1171411423300012929Vadose Zone SoilMTLWAMRGAVLGKGPWLLIRNDGNLDRLRNSSRKRRLVTHDLNQQMTLFK*
Ga0164299_1168665023300012958SoilMTLWAMRGAVLGKGPWLLIRNDENLNRLCNSPRKRRLITHDLN
Ga0181517_1006757713300014160BogMTLWAMRGAVLGKGPWLLIRNEQNLDRLRNSPRKRGIVTHYLNEQMPLFK*
Ga0181517_1014842223300014160BogMRAAILGKGPWLLIRNENNLDRLRNSPRKRRLVTHDLNAQLTLFK*
Ga0181531_1008408133300014169BogMTLWAMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVSHELNQQLTLFK*
Ga0182019_1020506913300014498FenMTLWALRGAILGKGPWLVIQSEQNLDRLRNSPRKRTLVSDQL
Ga0182019_1084965923300014498FenMTLWAMRGAVLGNGPWLLIQNEGNLDRLHNSPRHRRLVSHDLH
Ga0181522_1063538923300014657BogMTLWAMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVSHE
Ga0182030_1089696613300014838BogMTLWALRVAVLGDGPWLMIRSEKNLDRLRNTSRKRG
Ga0182033_1182129723300016319SoilMTLWALRVAILGKGPWLLIRSEENLDRLRNSPRKRALVSDQLAQSA
Ga0187879_1012485913300017946PeatlandMTLWAMRGAVLGKGPWLLIRNEENLDRLRNSPRKRGIVTHYLNEQMPLFK
Ga0187847_1007600513300017948PeatlandMTLWAMRAAILGKGPWLLIRNENNLDRLRNSPRKRRLVTHDLNAQLTLFK
Ga0187779_1036529513300017959Tropical PeatlandMTLWAMRGAILGKGPWLLIQDGKNLDRLRNSPRKRRLVSHDLNQQMTLFKQTVF
Ga0181520_1026071123300017988BogMRAAILGKGPWLLIRNENNLDRLRNSPRKRRLVTHDLNAQLTLFK
Ga0187767_1007478513300017999Tropical PeatlandMTLWAMRGAILGKGPWLLIQDGKNLDRLRNSPRKRRLVSHDLSQQMILFKQTVF
Ga0187869_1037321823300018030PeatlandMTLWALRVAILGDGPWRVIQSEENLDRLRNSPRQRGLA
Ga0187771_1013048233300018088Tropical PeatlandMTLWALRGAVLGRGAWLLIRDPQNLDRLRNSPRNRYMVSYDLNQQISLFS
Ga0181504_138938323300019258PeatlandMTLWAMRAAILGKGPWLLIRNENNLDRLRNSPRKRQLVTHDLNAQLTLFK
Ga0181512_157930443300019270PeatlandMTLWAMRGAVLGKGPWLLIRNEQNLDRLRNSPRKRGIVTHYLNEQMPLFK
Ga0182022_121170813300019785FenMTLWALRGAILGKGPWLLIQSEQNLDRLRNSPRKRTLVSDQLARSAKHRSQA
Ga0163151_1051581913300020057Freshwater Microbial MatMTLWALRGAILGDGPWLMIRSEKNLDRLRNSPRRRALASDSLS
Ga0210396_1045015313300021180SoilMTLWAMRGAILGKGPWLLIRNEENLNRLRNSPRKRRLTTHD
Ga0213876_1067888813300021384Plant RootsMTLWALRVAVLGRGPWLLIRDEHQLKRLCNSPRRRRLASHDLNE
Ga0210393_1018262713300021401SoilMTLWAMRGAILGKGPWLLIRNEENLNRLRNSPRKRRLATHDLNEQMTLL
Ga0210390_1118097913300021474SoilMRGAILGKGPWLLIRNEENLNRLRNSPRKRRLATHD
Ga0187846_1009109513300021476BiofilmMTLWAMRGAVLGKGPWLLIRNDENLDRLRNSPRKRRLVSHDLSEQMPLFK
Ga0187846_1017196423300021476BiofilmMTLWALRGAVLGRGAWLLIRDPQNLDRLRNSPRKRTMVSHELNEQISLFF
Ga0224538_100514213300022520SoilMTLWALRGAILGKGPWLLIQSEQNLDRLRNSPRKRTLV
Ga0224520_100795113300023075SoilMTLWALRGAILGKGPWLLIQSEQNLDRLRNSPRKRTLVS
Ga0224555_104349523300023088SoilMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVSHELNQQLTLFK
Ga0208194_107746313300025412PeatlandMRGAVLGKGPWLLIRNEENLDRLRNSPRKRGIVTHYLNEQMP
Ga0207930_113687413300025604Arctic Peat SoilMRAAVLGKGPWLLIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK
Ga0209014_1006994733300025857Arctic Peat SoilMTLWALRVAVLGDGPWLVIRSEKNLDRLRNTSRQRGLTSDALR
Ga0209014_1009472023300025857Arctic Peat SoilMTLWALRGAILGDGPWRVIRSEKNLDRLRNTSRRRGLASDALS
Ga0209849_101113523300026215SoilMTLWAMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDLNEQMTLFR
Ga0209890_1005707023300026291SoilMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDLNEQMTLFR
Ga0209239_131329223300026310Grasslands SoilMTLWALRGAVLGDGPWRVISTEENMQRLQNSPRART
Ga0257153_101230123300026490SoilMTLWAMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDLNEQMTLFK
(restricted) Ga0233416_1014667813300027799SedimentMTLWALRCAILGDGPWRVIRSEKNMERLENSPRKR
Ga0209274_1010395733300027853SoilMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNQQMTLFR
Ga0209283_1054254113300027875Vadose Zone SoilMTLWALRGAVLGKGPWLLIRSEKNLDRLRNSPRKRALISDD
Ga0209068_1013159223300027894WatershedsMTLWALRGAILGKGPWLLIHSEKHLDRLRNTPRKRNLTSHELGEGIQEMSQLSLF
(restricted) Ga0233418_1004345013300027995SedimentMTLWALRRAVLGAGPWLMIASERNLDRLMNSPRKRQP
Ga0255358_101006223300028069SoilMTLWALRGAILGKGPWLVIQSEQNLDRLRNSPRKRTLVSDQPARSAQ
Ga0302294_1014041713300028740FenMSLWALRGAVLSIGAWLLIRSQTNLDRLRNSLRKRVLSSDRLARS
Ga0302156_1016452013300028748BogMALWAMRGAVLGRGPWLLIRNDKNLDRLRNSPRKRRLVSHDLNEQA
Ga0302225_1011863013300028780PalsaMRGAILGRGPWLLIRNQENLDRLRNSPRKRRLVSHELNQQLTLF
Ga0302276_1032634813300029992BogMALWAMRGAVLGRGPWLIIRNDKNLDRLRNSPRKRRLVSHDL
Ga0302325_1187223613300031234PalsaMRGAVLGKGPWLLIRNEQNLDRLRNSPRKRGIASHYLNEQM
Ga0302326_1242524023300031525PalsaLWAMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVTHDLNQQMTPFR
Ga0265313_1017388123300031595RhizosphereMTLWAMRGAVLGKGPWLLIRNDDNLDRLRNSSRKRRLVTHDL
Ga0318574_1064499013300031680SoilTLWAMRGAVLGKGPWLLIQNEDNLDRLRNSPRQRRLVSHDLHEQLTLFK
Ga0302319_1049536823300031788BogMTLWALRVAVLGRGPWLVIQDEQNLDRLRNSPRRRLVSHDLNAQIPL
Ga0318565_1052142413300031799SoilMTLWAIRGAVLGKGPWLVIRNNDHLDRLRNSPRKRPLISHYLHQQMTLF
Ga0318551_1058381123300031896SoilMTLWAIRGAVLGKGPWLVIRNNDHLDRLRNSPRKRPLISHYLHQQMTLFKSHLLME
Ga0308176_1117281513300031996SoilMTLWAMRGAILGKGPWLLIRKEENLNRLRNSPRKRRLTTHDLNEQITLF
Ga0315271_1051645623300032256SedimentMVLWALRGAILGKGPWLLIRSEKNLNRLRNSPRKRAL
Ga0335082_1025504613300032782SoilMTLWAMRGAIPGKGPWLLIRNEDNLERLRNSPRNRPLLSHDLHEQLPLFR
Ga0326728_1026875723300033402Peat SoilMRAAVLGKGPWLFIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK
Ga0326727_1006975143300033405Peat SoilMTLWAMRAAVLGKGPWLFIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK
Ga0334790_021344_1217_13693300033887SoilMTLWAMRGAILGKGPWLLIRNEENLDRLRNSPRKRRLVSHELNQQLTLFK
Ga0314861_0094724_148_2853300033977PeatlandMRGAVLGKGPWLLIRSDDHLDRLRNSPRQRRLVSHDLYEQLPLFK
Ga0326724_0488008_3_1163300034091Peat SoilGPWLFIRNEKNLDRLRNSPRKRRLVTHDLNEQMTLFK
Ga0370480_0144932_668_8113300034169Untreated Peat SoilMVLWALRGAILGKGPWLLIRSEKNLNRLRNSPRKRALVSHELALKVIA
Ga0370504_0005083_1314_14783300034349Untreated Peat SoilMVLWALRGAILGKGPWLLIRSEKNLNRLRNSPRKRALVSHELALKVTASPAVLI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.