NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090795

Metagenome Family F090795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090795
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 50 residues
Representative Sequence NIAWMPSEFSFVRLEYSHAKADAGIHPTDDRLAVQMSYTIGYHPAHAY
Number of Associated Samples 101
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 89.81 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(32.407 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.26%    Coil/Unstructured: 69.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF01297ZnuA 94.44
PF00950ABC-3 1.85
PF01047MarR 0.93
PF13620CarboxypepD_reg 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 1.85
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 1.85
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 1.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003995|Ga0055438_10150060All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium689Open in IMG/M
3300004013|Ga0055465_10163661All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300004077|Ga0055523_10094787All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300004114|Ga0062593_101283307All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium774Open in IMG/M
3300005345|Ga0070692_11325245All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300005364|Ga0070673_101935876All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium559Open in IMG/M
3300005468|Ga0070707_102175865All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005518|Ga0070699_102004048All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005526|Ga0073909_10671868All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium517Open in IMG/M
3300005536|Ga0070697_100252190All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300005536|Ga0070697_100327722All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300005536|Ga0070697_101334897All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005553|Ga0066695_10744558All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium570Open in IMG/M
3300005556|Ga0066707_10912504All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium538Open in IMG/M
3300005558|Ga0066698_10582116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium757Open in IMG/M
3300005598|Ga0066706_11027936All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005842|Ga0068858_100934154All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300006031|Ga0066651_10367930All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300006032|Ga0066696_10683649All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium660Open in IMG/M
3300006034|Ga0066656_10564204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium739Open in IMG/M
3300006173|Ga0070716_100386430All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300006796|Ga0066665_10751509All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium771Open in IMG/M
3300006852|Ga0075433_10098094All Organisms → cellular organisms → Bacteria2594Open in IMG/M
3300006852|Ga0075433_10111102All Organisms → cellular organisms → Bacteria2432Open in IMG/M
3300006854|Ga0075425_101941085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium659Open in IMG/M
3300006903|Ga0075426_10421297All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300006904|Ga0075424_101868938All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300007255|Ga0099791_10170896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1020Open in IMG/M
3300009089|Ga0099828_11818983All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium535Open in IMG/M
3300009094|Ga0111539_10188432All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2408Open in IMG/M
3300009137|Ga0066709_104547994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium507Open in IMG/M
3300009162|Ga0075423_10770376All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1017Open in IMG/M
3300009177|Ga0105248_12728885All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium563Open in IMG/M
3300010159|Ga0099796_10313294All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium668Open in IMG/M
3300010304|Ga0134088_10361881All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium705Open in IMG/M
3300010323|Ga0134086_10409538All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium546Open in IMG/M
3300010336|Ga0134071_10558986All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium595Open in IMG/M
3300010364|Ga0134066_10228547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium632Open in IMG/M
3300010376|Ga0126381_103090086All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium660Open in IMG/M
3300010397|Ga0134124_11541792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium693Open in IMG/M
3300010398|Ga0126383_10859164All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium992Open in IMG/M
3300010398|Ga0126383_12442849All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium607Open in IMG/M
3300010403|Ga0134123_11162000All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium800Open in IMG/M
3300012203|Ga0137399_11235797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium629Open in IMG/M
3300012211|Ga0137377_11577219All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium581Open in IMG/M
3300012351|Ga0137386_11247492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium518Open in IMG/M
3300012362|Ga0137361_11507803All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium594Open in IMG/M
3300012685|Ga0137397_10395864All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1029Open in IMG/M
3300012917|Ga0137395_11297452All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium503Open in IMG/M
3300012918|Ga0137396_11283221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium510Open in IMG/M
3300012922|Ga0137394_11332384All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium580Open in IMG/M
3300012925|Ga0137419_11702663All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium538Open in IMG/M
3300012944|Ga0137410_10998539All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium712Open in IMG/M
3300012971|Ga0126369_13308664All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium528Open in IMG/M
3300013306|Ga0163162_11117448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium893Open in IMG/M
3300014311|Ga0075322_1056525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium865Open in IMG/M
3300014494|Ga0182017_10520747All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium728Open in IMG/M
3300015052|Ga0137411_1027358All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium573Open in IMG/M
3300016270|Ga0182036_11072322All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium666Open in IMG/M
3300016341|Ga0182035_10498929All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1039Open in IMG/M
3300016371|Ga0182034_10074536All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2341Open in IMG/M
3300016422|Ga0182039_10187465All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300017927|Ga0187824_10007022All Organisms → cellular organisms → Bacteria3176Open in IMG/M
3300017959|Ga0187779_10597092All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium739Open in IMG/M
3300018433|Ga0066667_10981139All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium728Open in IMG/M
3300018468|Ga0066662_10614837All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1020Open in IMG/M
3300019362|Ga0173479_10193066All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium852Open in IMG/M
3300019785|Ga0182022_1132114All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium542Open in IMG/M
3300019879|Ga0193723_1064134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1066Open in IMG/M
3300023311|Ga0256681_11746257All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium624Open in IMG/M
3300025939|Ga0207665_10364622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1093Open in IMG/M
3300026352|Ga0210107_1038421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium737Open in IMG/M
3300026538|Ga0209056_10081938All Organisms → cellular organisms → Bacteria2717Open in IMG/M
3300026540|Ga0209376_1075785All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300026557|Ga0179587_10907351All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium581Open in IMG/M
3300027815|Ga0209726_10547296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium511Open in IMG/M
3300027874|Ga0209465_10444513All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium648Open in IMG/M
3300028536|Ga0137415_11413699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium518Open in IMG/M
3300031544|Ga0318534_10051321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2309Open in IMG/M
3300031564|Ga0318573_10615981All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium584Open in IMG/M
3300031716|Ga0310813_10457774All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1108Open in IMG/M
3300031723|Ga0318493_10370524All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium780Open in IMG/M
3300031740|Ga0307468_100801828All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium803Open in IMG/M
3300031740|Ga0307468_101822106All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium577Open in IMG/M
3300031747|Ga0318502_10331525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium898Open in IMG/M
3300031748|Ga0318492_10299997All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium836Open in IMG/M
3300031769|Ga0318526_10125974All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1035Open in IMG/M
3300031771|Ga0318546_10568887All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium796Open in IMG/M
3300031777|Ga0318543_10561956All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium511Open in IMG/M
3300031779|Ga0318566_10031895All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2426Open in IMG/M
3300031779|Ga0318566_10088049All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300031795|Ga0318557_10124540All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1154Open in IMG/M
3300031820|Ga0307473_10599252All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium760Open in IMG/M
3300031831|Ga0318564_10023268All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2590Open in IMG/M
3300031860|Ga0318495_10315646All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium694Open in IMG/M
3300031946|Ga0310910_10771305All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium758Open in IMG/M
3300032055|Ga0318575_10118642All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300032064|Ga0318510_10183255All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium840Open in IMG/M
3300032067|Ga0318524_10225845All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium960Open in IMG/M
3300032068|Ga0318553_10262342All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium903Open in IMG/M
3300032261|Ga0306920_100411173All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300032770|Ga0335085_10059794All Organisms → cellular organisms → Bacteria5095Open in IMG/M
3300032829|Ga0335070_11922274All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium533Open in IMG/M
3300032897|Ga0335071_11986851All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium525Open in IMG/M
3300032955|Ga0335076_11199760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium643Open in IMG/M
3300032955|Ga0335076_11617910All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium536Open in IMG/M
3300033004|Ga0335084_12399818All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium508Open in IMG/M
3300033433|Ga0326726_11524192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium651Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004077Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026352Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055438_1015006023300003995Natural And Restored WetlandsFSYVRLEYDYLRADGGNGIKPTDQRVMLQFDYTIGYHPAHAY*
Ga0055465_1016366113300004013Natural And Restored WetlandsWTPSEFSYVRLEYSYAQADDGNGFKPTDQRVMIQFNYTIGYHPAHAY*
Ga0055523_1009478713300004077Natural And Restored WetlandsSGKVTRGSANIAWMPSEFSYVRLEYSHAKADAGVHPTDDRLTLQMSTRIGHHPAHAY*
Ga0062593_10128330713300004114SoilSEFSYIRLEYSHSKADAGIHPTDDRVMLQLSYTIGYHPAHPY*
Ga0070692_1132524523300005345Corn, Switchgrass And Miscanthus RhizosphereDPIPATVTRGAVNVAWAPSEFSFVRLEYSHGEADRGIHPTDDRIMIQMSYTIGYHPAHAY
Ga0070673_10193587623300005364Switchgrass RhizosphereEFSFVRLEYSHAKADAGIHPTDDRVLVQLSYTIGYHPAHAY*
Ga0070707_10217586523300005468Corn, Switchgrass And Miscanthus RhizosphereSANIAWTPSEFSSVRLEYSHAQADAGSGVKPNDDRLMIQMSYTIGYHPAHAF*
Ga0070699_10200404823300005518Corn, Switchgrass And Miscanthus RhizosphereAEIPGKVNRGSVNIAWTPSEFSFIRLEYSHAKADMGIHPSDDRVLIQMSYTIGYHPAHAY
Ga0073909_1067186823300005526Surface SoilVRLEYSHGEADRGVHPTDDRIMIQMSYTIGYHPAHAY*
Ga0070697_10025219033300005536Corn, Switchgrass And Miscanthus RhizosphereSEFSFVRLEYSHAKTDDGIHPTDDRIMLQMSYTIGYHPAHAY*
Ga0070697_10032772233300005536Corn, Switchgrass And Miscanthus RhizosphereRGNANIQWMPSEFSFVRFEYSHAKADNGAGINPTDDRFMVQMSYTIGFHPAHAY*
Ga0070697_10133489713300005536Corn, Switchgrass And Miscanthus RhizosphereNIAWTPSEFSFIRLEYSHAKADVGIHPTDDRVLLQMSYTIGYHPAHAY*
Ga0066695_1074455823300005553SoilEFSFVRLEYSRANADDGHGAKPTDDRIMAQLSYTIGYHPAHAY*
Ga0066707_1091250423300005556SoilTPSEFSFVRLEYSHAKANAGIHPTDDRLMIQMSYTIGYHPAHAY*
Ga0066698_1058211613300005558SoilEYSHAKADNGAGINPTDDRFMVQMSYTIGYHPAHAY*
Ga0066706_1102793623300005598SoilRASANIAWMPSEFSFVRLEYSHAKGDAGIHPTDDRIAVQMSYTIGYHPAHAY*
Ga0068858_10093415413300005842Switchgrass RhizosphereSAVRGAVSRGTVNIAWVPSEFSCVRLEYSHAKADVGAHPTDDRILLQLSYTIGFHPAHAY
Ga0066651_1036793023300006031SoilAWVPSEFSFIRLEYSHAKADGGIHPTDDRLMIQMSYTIGYHPAHAY*
Ga0066696_1068364923300006032SoilEFSFIRLEYSHAKADAGIHPTDDRIAVQMSYTIGYHPAHAY*
Ga0066656_1056420413300006034SoilPSEFSFVRLEYSHAQADGGGGITPDDDRLAIQMSYTIGYHPAHAY*
Ga0070716_10038643023300006173Corn, Switchgrass And Miscanthus RhizosphereGKVTRGNANIEWMPSEFSFLRFEYSHAKADNGAGIDPTDDRFMVQMSYTIGYHPAHAY*
Ga0066665_1075150923300006796SoilSEFSFVRLEYSRANADDGHGAKPTDDRIMAQLSYTIGYHPAHAY*
Ga0075433_1009809443300006852Populus RhizospherePSEFSSVKFEYSHANADDGAGNSPTDDRFMVQMSYTIGYHPAHAY*
Ga0075433_1011110243300006852Populus RhizosphereVSANIAWTPSEFSFMRIEYSHATADAGNGLKPDDDRIMIQMSYTIGYHPAHAY*
Ga0075425_10194108513300006854Populus RhizosphereAWTPSEFSFVRLEYSHAQADGGNGIKPNDDRILIQMSYTIGYHPAHAY*
Ga0075426_1042129713300006903Populus RhizospherePATVRRGSVNVAWTPSEFSFVRLEYSHAKADAGIHPSDDRLLIQMSYTIGYHPAHAY*
Ga0075424_10186893813300006904Populus RhizospherePGRVNRGSINIAWMPSEFSFVRLEYSHSEANTGIHPTDDRLLLQLSYTIGYHPAHAY*
Ga0099791_1017089613300007255Vadose Zone SoilKVNRASANIAWMPSEFSFIRFEYSHAKADAGIHPTDDRIAVQMSYTIGYHPAHAY*
Ga0099828_1181898323300009089Vadose Zone SoilNVAWTPSEFSFVRLEYSHAKADGGIHPTDDRIMIQMSYTIGYHPAHAY*
Ga0111539_1018843243300009094Populus RhizosphereDTGAQIAGKVNRSSLNIAWTPSEFSFLRLEYSHSKADAGIHPTDDRILLQVSYTIGYHPAHAY*
Ga0066709_10454799423300009137Grasslands SoilFIRLEYSHAQADGGNGIQPNDDRLMIQMSYTIGYHPAHAY*
Ga0075423_1077037623300009162Populus RhizosphereYSHAKADDGAGNSPTDDRFMVQMSYTIGYHPAHAY*
Ga0105248_1272888523300009177Switchgrass RhizosphereSINIAWMPSEFSFVRLEYSHSKADAGIHPTDDRLLLQLSYTLGYHPAHAY*
Ga0099796_1031329413300010159Vadose Zone SoilGKINRASANIAWMPSEFSFVRLEYSHAQADAGGGIKPNDDRIMIQMSYTIGYHPAHAY*
Ga0134088_1036188123300010304Grasslands SoilAKVNRASVNIAWAPSEFSFVRLEYSHGKADAGIHPTDDRIMIQMSYTIGYHPAHAY*
Ga0134086_1040953823300010323Grasslands SoilEFSFVRLEYSHSKADAGVHPTDDRLMIQMSYTIGYHPAHAY*
Ga0134071_1055898623300010336Grasslands SoilGSANIAWSPSEFSFVRLEYSHAEADGGIHPTDDRILLQLSYTIGYHPAHAY*
Ga0134066_1022854713300010364Grasslands SoilAPIGATVSRGAANLAWAPSEFSFVRLEYSHAKADAGVHPTDDRILVQLSYTIGYHPAHAY
Ga0126381_10309008613300010376Tropical Forest SoilTGAAVAGTVHRASVNLAWTPSEFSFIRLEYSHAKAGAGVHPTDDRILLQLSYTIGYHPAHAY*
Ga0134124_1154179223300010397Terrestrial SoilAWAPSEFSFVRLEYSHAKADAGVHPSDDRILLQLSYTIGYHPAHAY*
Ga0126383_1085916413300010398Tropical Forest SoilIRLEYSHSKADKGIHPTDDRIMLQMSYTIGFHPAHAY*
Ga0126383_1244284913300010398Tropical Forest SoilSFVRLEYSHSKADAGAHPTDDRIMVQMSFTIGFHPAHAY*
Ga0134123_1116200023300010403Terrestrial SoilVQWSPSEFSFIRLEYSHAKADAGVHPTDDRLMVQMSYTIGFHPAHAY*
Ga0137399_1123579723300012203Vadose Zone SoilFLVDAVGDPLAGKVSRGSVNIAWMPSEFSFVRLEYSHARADDGNGFKPTDDRLMVQLSYTIGYHPAHSY*
Ga0137377_1157721923300012211Vadose Zone SoilFVRLEYSHAKADAGIHPTDDRVMIQMSYTIGYHPAHAY*
Ga0137386_1124749213300012351Vadose Zone SoilSHAEADGGNGLKPNDDRLMIQMSYTIGYHPAHAY*
Ga0137361_1150780313300012362Vadose Zone SoilIPGKINRASANIAWMPSEFSFVRLEYSHAQADAGGGIKPNDDRIMIQMSYTIGYHPAHAY
Ga0137397_1039586413300012685Vadose Zone SoilLEYSHAVADGGNGIKPNDDRLIVQMSYTIGYHPAHAY*
Ga0137395_1129745223300012917Vadose Zone SoilAWMPSEFSFVRLEYSHAQADAGGGIKPNDDRIMIQMSYTIGYHPAHAY*
Ga0137396_1128322113300012918Vadose Zone SoilSEFSFLRLECSHAKADGGIHPTDDRLAVQMSYTIGYHPAHSY*
Ga0137394_1133238413300012922Vadose Zone SoilEYSHAKADGGNGVKPNDDRLMIQFSYTIGYHPAHAY*
Ga0137419_1170266323300012925Vadose Zone SoilSANIAWVPSEFSFVRLEYSHARADDGNGFKPTDDRLMVQLSYTIGYHPAHAY*
Ga0137410_1099853913300012944Vadose Zone SoilPIAGKVNRVSANISWVPSEFSFVRLEYSHAKADGGINPTDDRLALQMSYTIGYHPAHSY*
Ga0126369_1330866413300012971Tropical Forest SoilSPSEFSFIRLEYSHAKADAGVHPTDDRLMIEMSYTIGYHPAHAY*
Ga0163162_1111744813300013306Switchgrass RhizosphereVNLAWSPSEFSFIRVEYSHAKADAGIHPTDDRLLIQFSYTIGYHPAHAY*
Ga0075322_105652523300014311Natural And Restored WetlandsWLPSEFSSVRLEYSHAVGDIGNGSKPNDDRIMLQMSFTIGYHPAHAY*
Ga0182017_1052074723300014494FenFSFVRLEYSHARADVGIHRSDDRLMVQMSYTIGYHPAHAY*
Ga0137411_102735823300015052Vadose Zone SoilFSFLRLEYSHAKADAGIHPTDDRIAIQMSYTIGYHPAHAY*
Ga0182036_1107232223300016270SoilVPGTVHRGSVNIAWTPSEFSFIRLEYSHSKASAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0182035_1049892923300016341SoilAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0182034_1007453643300016371SoilVVDDAGAPVPATVHRGSVNIAWTPSEFSFVRLEYSHSKADAGVHPTDDRLLLQLSYTIGYHPAHAY
Ga0182039_1018746533300016422SoilPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0187824_1000702253300017927Freshwater SedimentLVDGAGDPVRGKVTRGNANIEWMPSEFSFVRFEYSHAKADNGAGINPTDDRFMVQMSYTIGYHPAHAY
Ga0187779_1059709223300017959Tropical PeatlandFSFIRLEYSHSKADAGIHPTDDRLMLQLSYTIGFHPAHAY
Ga0066667_1098113913300018433Grasslands SoilFLVDTAGDPIPGKVTRGNANIQWMPSEFSFVRFEYSHAKADNGAGINPTDDRFMVQMSYTIGYHPAHAY
Ga0066662_1061483713300018468Grasslands SoilNRASANVAWTPSEFSFVRLEYSHAKADAGIHPTDDRVMIQMSYTIGYHPAHAY
Ga0173479_1019306623300019362SoilGKVDRGSVNVAWAPSEFSFVRLEYSHARADAGIHPTDDRVLIQLSYTIGYHPAHAY
Ga0182022_113211423300019785FenRRVSANVAWTPSEFSFVRLEYSVARADDGKGIAPLDRRLMVQLCYTIGYHPAHAY
Ga0193723_106413423300019879SoilFSFVRFEYSHAKADNGAGIQPTDDRFMVQMSYTIGYHPAHAY
Ga0256681_1174625723300023311FreshwaterWMPSEFSFVRLEYSHATADAGVHPSDDRIAIQMSYTIGYHPAHAY
Ga0207665_1036462213300025939Corn, Switchgrass And Miscanthus RhizosphereVTRGNANIEWMPSEFSFLRFEYSHAKADNGAGIDPTDDRFMVQMSYTIGYHPAHAY
Ga0210107_103842123300026352Natural And Restored WetlandsSGKVTRGSANIAWMPSEFSYVRLEYSHAKADAGVHPTDDRLTLQMSTRIGHHPAHAY
Ga0209056_1008193813300026538SoilPVAAKVNRASVNIAWMPSEFSFVRLEYSHAKGDAGIHPTDDRIAVQMSYTIGYHPAHAY
Ga0209376_107578513300026540SoilGTPIPGKVNRGSFNIAWMPSEFSFLRLEYSHSKADAGIHPTDDRILLQLSYTIGYHPAHA
Ga0179587_1090735123300026557Vadose Zone SoilKINRGSANIAWMPSEFSFVRLEYSHAKADAGIHPTDDRIMIQMSYTIGYHPAHAY
Ga0209726_1054729623300027815GroundwaterVDQAGDPIPGKVTRGNANIAWMPSEFSFVRFEYSHAKADNGAGINPTDDRFMVQMSYTIGYHPAHAY
Ga0209465_1044451323300027874Tropical Forest SoilSEFSFIRLEYSHAKAGAGVHPTDDRILVELSYTIGYHPAHAY
Ga0137415_1141369923300028536Vadose Zone SoilNIAWMPSEFSFVRLEYSHAKADAGIHPTDDRLAVQMSYTIGYHPAHAY
Ga0318534_1005132133300031544SoilMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318573_1061598113300031564SoilASANIAWTPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0310813_1045777423300031716SoilNRGSVNIAWTPSEFSFVRLEYSHAKANAGIHPTDDRLLLQLSYTIGYHPAHAY
Ga0318493_1037052423300031723SoilFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0307468_10080182823300031740Hardwood Forest SoilGLPVPGKISRGSVNLAWMPSEFSFVRIEYSHAEGDAGSGIEPNDDRVMLQLSYTIGYHPAHAY
Ga0307468_10182210613300031740Hardwood Forest SoilVPGAVTRGSANLQWAPSEFSYIRLEYSHAKADAGIHPTDDRLLVQMSYTIGFHPAHAY
Ga0318502_1033152523300031747SoilVHRASANIAWTPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318492_1029999713300031748SoilSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318526_1012597423300031769SoilAWTPSEFSFIRLEYSHSKASAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318546_1056888723300031771SoilFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318543_1056195613300031777SoilVDDAGNPVAATVDRGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318566_1003189543300031779SoilVHGAPVPATVHRGSVNIAWTPSEFSFVRLEYSHSKADAGVHPTDDRLLLQLSYTIGYHPAHAY
Ga0318566_1008804933300031779SoilGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318557_1012454013300031795SoilDDAGNPVAATVDRGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0307473_1059925213300031820Hardwood Forest SoilISRGSVNLAWMPSEFSFVRIEYSHAEGDAGSGIEPNDDRVMLQLSYTIGYHPAHAY
Ga0318564_1002326813300031831SoilANIAWTPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318495_1031564613300031860SoilGNPVAATVDRGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHA
Ga0310910_1077130513300031946SoilDAGNPVPATVDRGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318575_1011864213300032055SoilWTPSEFSFIRLEYSHSKASAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318510_1018325513300032064SoilVDRGSVNLAWMPSEFSFVRLEYSHSKASAGVHPTDDRIMLQLSYTIGFHPAHAY
Ga0318524_1022584523300032067SoilEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0318553_1026234223300032068SoilAWTPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0306920_10041117313300032261SoilIAWTPSEFSFIRLEYSHAKADAGVHPTDDRILLQLSYTIGYHPAHAY
Ga0335085_1005979453300032770SoilTPSEFSFIRLEYSHAKADVGVHPTDDRILIQMSYTIGYHPAHAY
Ga0335070_1192227423300032829SoilFSFVRLEYSHATAGAGIHPTDDRLMIQLSYTIGYHPAHAY
Ga0335071_1198685123300032897SoilGKVTRASANLAWMPSEFSFVRLEYSHAKADGGIHPTDDRLAVQMSYTIGYHPAHAY
Ga0335076_1119976023300032955SoilGAALAGKVNRASANVSWAPSEFSFVRIEYSHAKADAGIHPTDDRLMIQMSYTIGYHPAHA
Ga0335076_1161791023300032955SoilGTVHRASVNVAWTPSEFSFVRLEYSHATAGAGVHPTDDRLMIQLSYTIGYHPAHAY
Ga0335084_1239981823300033004SoilNIAWTPSEFSFIRLEYSHAKADTGIHPTDDRLLIQLSYTIGYHPAHAY
Ga0326726_1152419213300033433Peat SoilPGTVHRASVNVAWTPSEFSFVRLEYSHATAGAGIHPTDDRLMIQLSYTIGYHPAHAY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.