


| Basic Information | |
|---|---|
| Family ID | F090693 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSDRPLSRIRQLTALCMLVAAVVTIGLAIAGALKGARSPVPQLASQK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.37 % |
| % of genes near scaffold ends (potentially truncated) | 58.33 % |
| % of genes from short scaffolds (< 2000 bps) | 86.11 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.704 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.296 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 3.70 |
| PF04471 | Mrr_cat | 1.85 |
| PF02371 | Transposase_20 | 1.85 |
| PF09538 | FYDLN_acid | 1.85 |
| PF01939 | NucS | 1.85 |
| PF04357 | TamB | 0.93 |
| PF02538 | Hydantoinase_B | 0.93 |
| PF09509 | Hypoth_Ymh | 0.93 |
| PF02536 | mTERF | 0.93 |
| PF01522 | Polysacc_deac_1 | 0.93 |
| PF04226 | Transgly_assoc | 0.93 |
| PF07045 | DUF1330 | 0.93 |
| PF12706 | Lactamase_B_2 | 0.93 |
| PF01638 | HxlR | 0.93 |
| PF02656 | DUF202 | 0.93 |
| PF13560 | HTH_31 | 0.93 |
| PF01103 | Omp85 | 0.93 |
| PF01068 | DNA_ligase_A_M | 0.93 |
| PF04545 | Sigma70_r4 | 0.93 |
| PF01844 | HNH | 0.93 |
| PF13495 | Phage_int_SAM_4 | 0.93 |
| PF03734 | YkuD | 0.93 |
| PF08543 | Phos_pyr_kin | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.70 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.85 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 1.85 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.85 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.93 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.93 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.93 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.93 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.93 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.70 % |
| Unclassified | root | N/A | 46.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_53960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300000956|JGI10216J12902_105435226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1586 | Open in IMG/M |
| 3300001431|F14TB_102051787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300002568|C688J35102_120710025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
| 3300005332|Ga0066388_101029844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1383 | Open in IMG/M |
| 3300005332|Ga0066388_106898614 | Not Available | 572 | Open in IMG/M |
| 3300005337|Ga0070682_101250649 | Not Available | 629 | Open in IMG/M |
| 3300005343|Ga0070687_100500130 | Not Available | 818 | Open in IMG/M |
| 3300005343|Ga0070687_100774400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300005366|Ga0070659_100170654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1782 | Open in IMG/M |
| 3300005366|Ga0070659_100442327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1102 | Open in IMG/M |
| 3300005439|Ga0070711_100080764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
| 3300005713|Ga0066905_100022820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3374 | Open in IMG/M |
| 3300005713|Ga0066905_100138215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1733 | Open in IMG/M |
| 3300005713|Ga0066905_100603387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni | 929 | Open in IMG/M |
| 3300005713|Ga0066905_100816600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300005713|Ga0066905_101057915 | Not Available | 718 | Open in IMG/M |
| 3300005764|Ga0066903_103200583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 885 | Open in IMG/M |
| 3300005842|Ga0068858_100498124 | Not Available | 1177 | Open in IMG/M |
| 3300005937|Ga0081455_10031010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4845 | Open in IMG/M |
| 3300005937|Ga0081455_10084579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2589 | Open in IMG/M |
| 3300005937|Ga0081455_10088581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2514 | Open in IMG/M |
| 3300005937|Ga0081455_10382827 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300006038|Ga0075365_10026951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3652 | Open in IMG/M |
| 3300006038|Ga0075365_10037354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3153 | Open in IMG/M |
| 3300006038|Ga0075365_10055371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2632 | Open in IMG/M |
| 3300006038|Ga0075365_10186910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. S69 | 1449 | Open in IMG/M |
| 3300006038|Ga0075365_11341117 | Not Available | 502 | Open in IMG/M |
| 3300006175|Ga0070712_101326426 | Not Available | 627 | Open in IMG/M |
| 3300006604|Ga0074060_10007876 | Not Available | 619 | Open in IMG/M |
| 3300006844|Ga0075428_102693553 | Not Available | 507 | Open in IMG/M |
| 3300006847|Ga0075431_100642108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1043 | Open in IMG/M |
| 3300009094|Ga0111539_12059494 | Not Available | 662 | Open in IMG/M |
| 3300009100|Ga0075418_11568672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300009100|Ga0075418_11903162 | Not Available | 647 | Open in IMG/M |
| 3300009100|Ga0075418_12538119 | Not Available | 559 | Open in IMG/M |
| 3300009101|Ga0105247_11875416 | Not Available | 501 | Open in IMG/M |
| 3300009143|Ga0099792_10551232 | Not Available | 729 | Open in IMG/M |
| 3300010047|Ga0126382_10949262 | Not Available | 749 | Open in IMG/M |
| 3300010362|Ga0126377_10341190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → Xanthobacter flavus | 1491 | Open in IMG/M |
| 3300010401|Ga0134121_11247951 | Not Available | 746 | Open in IMG/M |
| 3300010403|Ga0134123_12271575 | Not Available | 606 | Open in IMG/M |
| 3300011000|Ga0138513_100028791 | Not Available | 799 | Open in IMG/M |
| 3300012211|Ga0137377_10583982 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300012212|Ga0150985_121431297 | Not Available | 906 | Open in IMG/M |
| 3300012356|Ga0137371_10970353 | Not Available | 645 | Open in IMG/M |
| 3300012469|Ga0150984_107928421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sGM-13 | 1792 | Open in IMG/M |
| 3300012924|Ga0137413_10740948 | Not Available | 749 | Open in IMG/M |
| 3300012924|Ga0137413_11134884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB030 | 620 | Open in IMG/M |
| 3300012924|Ga0137413_11747639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300012951|Ga0164300_10410678 | Not Available | 747 | Open in IMG/M |
| 3300012951|Ga0164300_11071219 | Not Available | 524 | Open in IMG/M |
| 3300012958|Ga0164299_10719726 | Not Available | 701 | Open in IMG/M |
| 3300012960|Ga0164301_11333342 | Not Available | 583 | Open in IMG/M |
| 3300012988|Ga0164306_10058267 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300013306|Ga0163162_12242014 | Not Available | 627 | Open in IMG/M |
| 3300013308|Ga0157375_10018265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6356 | Open in IMG/M |
| 3300014968|Ga0157379_12477020 | Not Available | 519 | Open in IMG/M |
| 3300015242|Ga0137412_10017683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5788 | Open in IMG/M |
| 3300015242|Ga0137412_10444200 | Not Available | 999 | Open in IMG/M |
| 3300015371|Ga0132258_13751938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
| 3300015372|Ga0132256_101632435 | Not Available | 754 | Open in IMG/M |
| 3300015372|Ga0132256_102849704 | Not Available | 581 | Open in IMG/M |
| 3300017965|Ga0190266_10173761 | Not Available | 998 | Open in IMG/M |
| 3300018027|Ga0184605_10000698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10232 | Open in IMG/M |
| 3300018028|Ga0184608_10523270 | Not Available | 506 | Open in IMG/M |
| 3300018031|Ga0184634_10242633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300018066|Ga0184617_1164713 | Not Available | 655 | Open in IMG/M |
| 3300018067|Ga0184611_1059357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300018074|Ga0184640_10238835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300018081|Ga0184625_10406086 | Not Available | 702 | Open in IMG/M |
| 3300018469|Ga0190270_11175355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 804 | Open in IMG/M |
| 3300019876|Ga0193703_1020128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300019890|Ga0193728_1241379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300020002|Ga0193730_1031630 | Not Available | 1533 | Open in IMG/M |
| 3300021078|Ga0210381_10308753 | Not Available | 572 | Open in IMG/M |
| 3300025927|Ga0207687_10604791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300025933|Ga0207706_11635865 | Not Available | 521 | Open in IMG/M |
| 3300025936|Ga0207670_11535102 | Not Available | 566 | Open in IMG/M |
| 3300025937|Ga0207669_11369788 | Not Available | 602 | Open in IMG/M |
| 3300025938|Ga0207704_11678399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300025961|Ga0207712_11675301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300026035|Ga0207703_11977955 | Not Available | 559 | Open in IMG/M |
| 3300026142|Ga0207698_12434383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300028710|Ga0307322_10045883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
| 3300028717|Ga0307298_10003979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3519 | Open in IMG/M |
| 3300028719|Ga0307301_10174905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300028720|Ga0307317_10076355 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300028720|Ga0307317_10179774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300028720|Ga0307317_10298515 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300028755|Ga0307316_10026776 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300028768|Ga0307280_10101125 | Not Available | 958 | Open in IMG/M |
| 3300028768|Ga0307280_10106507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300028768|Ga0307280_10396492 | Not Available | 514 | Open in IMG/M |
| 3300028791|Ga0307290_10018070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2438 | Open in IMG/M |
| 3300028793|Ga0307299_10001250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8524 | Open in IMG/M |
| 3300028819|Ga0307296_10743244 | Not Available | 535 | Open in IMG/M |
| 3300028875|Ga0307289_10253191 | Not Available | 724 | Open in IMG/M |
| 3300028876|Ga0307286_10197945 | Not Available | 729 | Open in IMG/M |
| 3300028881|Ga0307277_10103919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1206 | Open in IMG/M |
| 3300028884|Ga0307308_10495366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300028884|Ga0307308_10499206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300030993|Ga0308190_1185411 | Not Available | 516 | Open in IMG/M |
| 3300031231|Ga0170824_103077582 | Not Available | 894 | Open in IMG/M |
| 3300031421|Ga0308194_10321878 | Not Available | 542 | Open in IMG/M |
| 3300031424|Ga0308179_1040942 | Not Available | 578 | Open in IMG/M |
| 3300031740|Ga0307468_100805835 | Not Available | 801 | Open in IMG/M |
| 3300032205|Ga0307472_101190544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 28.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.63% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00619680 | 2199352025 | Soil | MSDRHLTRIGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK |
| JGI10216J12902_1054352263 | 3300000956 | Soil | MSDRPLSRIRQLTALCMLVAAVVTIGLAIAGALKGARSPVPQLASQK* |
| F14TB_1020517873 | 3300001431 | Soil | IRQLVALCMLVAAVVTIGLVIAGALTGARSPVPQLASQK* |
| C688J35102_1207100251 | 3300002568 | Soil | MSDRHLTRIGRLITLCLLLAAVVMIGLAISGALKEARSPV |
| Ga0066388_1010298442 | 3300005332 | Tropical Forest Soil | MSERHITRIGHLTALCMLVAAVVTIGLAIAGALKGANALVPQPQLASHK* |
| Ga0066388_1068986142 | 3300005332 | Tropical Forest Soil | MIAKLPMSEAMSERHTTRIGRLTALCMLVAAVVTIGLAIAGALKEARAPVPQLASHK* |
| Ga0070682_1012506491 | 3300005337 | Corn Rhizosphere | MSARPLSRIRQLIALCMLAAAVVTIGLAIAGALTGARPPAPQLASQK* |
| Ga0070687_1005001302 | 3300005343 | Switchgrass Rhizosphere | MSARPLSRIRQLITLCMLAAAVVTIGLVIAGALTGARSPVPQLASQK* |
| Ga0070687_1007744001 | 3300005343 | Switchgrass Rhizosphere | MSDRHLTRTGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK* |
| Ga0070659_1001706543 | 3300005366 | Corn Rhizosphere | RPLSRIRQLITLCMLVAAVVTIGLAIAGALTGARSPVPQLASQK* |
| Ga0070659_1004423271 | 3300005366 | Corn Rhizosphere | MSDRHLTRIGRLTALCLLLAAVVMIGLAISGALKEARSPVPQLASH |
| Ga0070711_1000807641 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRHLTRIGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK* |
| Ga0066905_1000228204 | 3300005713 | Tropical Forest Soil | MNERHTTRIGRLIAIYLLVAAIVTIGLAIAGVLKESPPVPQLASQK* |
| Ga0066905_1001382154 | 3300005713 | Tropical Forest Soil | GRLTAFCLLIAAVVTIGLAIAGVLKEARSPVPQLASQK* |
| Ga0066905_1006033871 | 3300005713 | Tropical Forest Soil | MSERHVSRIGRLTAICLLVAAVVTVGLAIAGALKGARSPVPQLASQK* |
| Ga0066905_1008166002 | 3300005713 | Tropical Forest Soil | CSEAKLPMSERHTTRIGRLTALCMLIAAVVTIGLAIAGTLKGSRAPVPQLASHK* |
| Ga0066905_1010579152 | 3300005713 | Tropical Forest Soil | MIAKLPMSDAMSERHTTRIGRLTALCMLVAAVVTIGLAIAGALKEARAPVPQLASYK* |
| Ga0066903_1032005832 | 3300005764 | Tropical Forest Soil | MSDRPLNRMGRLTAFCMLVAAVVTIGLAIAGALKGARSPVLQLASHK* |
| Ga0068858_1004981241 | 3300005842 | Switchgrass Rhizosphere | RLMALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK* |
| Ga0081455_100310105 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQWIIAKLPMSERHVSRIGRLTALCLLVAAVVTIGLAIAGALKGARSPVPQLASQK* |
| Ga0081455_100845794 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQWVSLGLPMSERHTTRIGRLTALCMLVGAFVTIGLAIAGALKGARAPIPQLASHK* |
| Ga0081455_100885813 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQWMIAKLPMSDAMSERHTTRIGRLTALCMLVAAVVTIGSAIAGALKEARAPVPQLASHK |
| Ga0081455_103828272 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQWIIAKRPMSERHTTRRGRLTAFCLLVAAVVTIGLAIAGVLKEARSPVPQLASQK* |
| Ga0075365_100269513 | 3300006038 | Populus Endosphere | MSDRHLTRIRQLTALGLLFCAVVIIGLAIGALKDGRSPRVPELASHK* |
| Ga0075365_100373541 | 3300006038 | Populus Endosphere | LLDCAGMSDRHPTRIRQLTAFCLLFCAVVIVGLAIAGALKDGRSPRVPELASQK* |
| Ga0075365_100553713 | 3300006038 | Populus Endosphere | MSDRRLTPIRQMVALGMLLAAVITFGLAIAGALNSVRSPVPQLASQK* |
| Ga0075365_101869103 | 3300006038 | Populus Endosphere | MSDRNLTRIRQLTAICLLLAAVIVIGLAISGAFKEVRSPVPQLASHK* |
| Ga0075365_113411172 | 3300006038 | Populus Endosphere | MSDRRLTPIGQLTAICLLVTAVVTIGLAIAGSLKGVRSPVPQLASQK* |
| Ga0070712_1013264261 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RIGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK* |
| Ga0074060_100078761 | 3300006604 | Soil | TLCMLAAAVVTIGLAIAGALTGARPPVPQLASQK* |
| Ga0075428_1026935532 | 3300006844 | Populus Rhizosphere | MSDRRLTPIGQLTAICLLVTAVVTIGLAIAGALKGVRSPVPQLASQK* |
| Ga0075431_1006421084 | 3300006847 | Populus Rhizosphere | LTPIRQMVALGMLLAAVITFGLAIAGALNSVRSPVPQLASQK* |
| Ga0111539_120594942 | 3300009094 | Populus Rhizosphere | MSDRPLSRIRQLITLCMLAAAVVTIGLAIAGALTGDQPPVP |
| Ga0075418_115686722 | 3300009100 | Populus Rhizosphere | MPITAKLPMNERHVSRIGRLTAFCLLVAAVVTIGLAIAGALKGARSPVPQLASQK* |
| Ga0075418_119031621 | 3300009100 | Populus Rhizosphere | MSDRPLSHVRQLVALCMLAAAVVTIGLAIAGALTGARSPVPQLASQK* |
| Ga0075418_125381192 | 3300009100 | Populus Rhizosphere | MSDRHLTRIGQLTALCLLLCAVVMIGLAIAGALKGTRSPVPELASQK* |
| Ga0105247_118754161 | 3300009101 | Switchgrass Rhizosphere | GRLIALGLLVAAVVIIGLAISGAFKWGPLPASELASQK* |
| Ga0099792_105512321 | 3300009143 | Vadose Zone Soil | QLITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK* |
| Ga0126382_109492623 | 3300010047 | Tropical Forest Soil | LMSERHTTRIGRLTALCMLVAAVVTIGLAIAGALKGARAPVPQPQLASHK* |
| Ga0126377_103411903 | 3300010362 | Tropical Forest Soil | GRLTALCMLVAAVVTIGLAIAGALKGAHAPVPQPQLASHK* |
| Ga0134121_112479512 | 3300010401 | Terrestrial Soil | IALGLLVAAVVIIGLAISGAFKWGPLPASELASQK* |
| Ga0134123_122715751 | 3300010403 | Terrestrial Soil | LDPAKLPMSDRHLTRIGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK* |
| Ga0138513_1000287912 | 3300011000 | Soil | GRLMALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK* |
| Ga0137377_105839822 | 3300012211 | Vadose Zone Soil | MSDHSLSRIRQLVALCMLAAAVVTIGRAIAGALTGVRPPVPQLASQK* |
| Ga0150985_1214312972 | 3300012212 | Avena Fatua Rhizosphere | MSDRHLTRIRQLAALCLLVAAVVTIGLAIAGALKGGRSPVPQLASQK* |
| Ga0137371_109703532 | 3300012356 | Vadose Zone Soil | VALCMLAAAVVTIGLAIAGALTGVRPPVPQLASQK* |
| Ga0150984_1079284212 | 3300012469 | Avena Fatua Rhizosphere | MSDRPLTRIRQWIALCMLVAAVVTIGFAIAGAPTRARPPVPQLASQKRPPAAAAGA |
| Ga0137413_107409481 | 3300012924 | Vadose Zone Soil | MSDRHLTRLRRLTALCLLFCAVVIIGLAISGALKEARSPV |
| Ga0137413_111348842 | 3300012924 | Vadose Zone Soil | RQLITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK* |
| Ga0137413_117476391 | 3300012924 | Vadose Zone Soil | MSDRHLTRIGRLITLCLLLAAVVMIGLAISGAMKEARSPVPQ |
| Ga0164300_104106782 | 3300012951 | Soil | ARPLSRIRQLIALCMLAAAVVTIGLAIAGALTGARPPAPQLASQK* |
| Ga0164300_110712191 | 3300012951 | Soil | MSARPLSRIRRLITLCMLAAAVVTIGLAIAGALTGA |
| Ga0164299_107197262 | 3300012958 | Soil | MSDRPLSRIHQLVALCMLVAAVVTVGLAIAGALTGARSPVPQLASQK* |
| Ga0164301_113333421 | 3300012960 | Soil | MSDRPLSRIRQLITLCMLAAAVVTIGLAIAGALTGFQPPVPQLASQK* |
| Ga0164306_100582673 | 3300012988 | Soil | MSDRHLTRMSRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK* |
| Ga0163162_122420142 | 3300013306 | Switchgrass Rhizosphere | MSDRPLTRIRQLITLCMLAAAVVTIGLVIAGALTGARSPVPQLASQK* |
| Ga0157375_100182651 | 3300013308 | Miscanthus Rhizosphere | MSDRPLSRIHQLVALCMVAAAVVTIGLAIAGALTGAQPPVPQLASQK* |
| Ga0157379_124770201 | 3300014968 | Switchgrass Rhizosphere | QWITAKLPMSDRHLTRIGRLTALCLLVAAVVMIGLAISGARKEARSPVPQLASHK* |
| Ga0137412_100176835 | 3300015242 | Vadose Zone Soil | MSDRPPSRIRQLITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK* |
| Ga0137412_104442002 | 3300015242 | Vadose Zone Soil | MSDRHLTRLRRLTALCLLFCAVVIIGLAISGALKEARSP |
| Ga0132258_137519382 | 3300015371 | Arabidopsis Rhizosphere | MSDRRLTPIGQLTAICLLVTAVVTIGLAIAGALKGVRSAVPQLASQK* |
| Ga0132256_1016324351 | 3300015372 | Arabidopsis Rhizosphere | MSDRPLSLIRQLIALCMLAAAVVTIGLAIAGALTGARPPVPQLASQK* |
| Ga0132256_1028497042 | 3300015372 | Arabidopsis Rhizosphere | AICLLVTAVVTIGLAIAGSLKGVRSPVPQLASQK* |
| Ga0190266_101737613 | 3300017965 | Soil | MSDRSLTPIRQLTALCLLLCAVVIIGFAISGALNSVRSPEPQLASQK |
| Ga0184605_100006987 | 3300018027 | Groundwater Sediment | MSDRHLTRIRRLTALCLLFCAVVIIGLAISGALKEARSPVPQLASHK |
| Ga0184608_105232701 | 3300018028 | Groundwater Sediment | MSDRPPSRIRQLITLCMLAAAVVTIGLAIAGALTGARPPVP |
| Ga0184634_102426332 | 3300018031 | Groundwater Sediment | MSDRHLTRTGRLITLCLLLAAVVMIGLAISGALKEARSPVPQ |
| Ga0184617_11647131 | 3300018066 | Groundwater Sediment | MSDRHLTRLRRLTALCLLFCAVVIIGLAISGALKEARSPVPQLASHK |
| Ga0184611_10593571 | 3300018067 | Groundwater Sediment | MSDRHLTRIRQLTAFCLLFCAVVIIGLAIAGALKDGRSPRVPELASQK |
| Ga0184640_102388353 | 3300018074 | Groundwater Sediment | RQLITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK |
| Ga0184625_104060862 | 3300018081 | Groundwater Sediment | GGRSARGTILLGCATMSDRSLTPIRQLTALCLLLCAVVIIGFAISGALNSVRSPEPQLASQK |
| Ga0190270_111753551 | 3300018469 | Soil | RIRQLITLCMLAAAVVTIGLVIAGALTGARSPVPQLASQK |
| Ga0193703_10201281 | 3300019876 | Soil | RHLTRIRRLTALCLLFCAVVIIGLAISGALKEARSPVPQLASHK |
| Ga0193728_12413791 | 3300019890 | Soil | MSNPHLIRIRQLTALCLLLCAIVTIGLAISGALKEARSPVPQL |
| Ga0193730_10316301 | 3300020002 | Soil | RRLTALCLLFCAMVIIGLAISGALKEARSPVPQLASHK |
| Ga0210381_103087532 | 3300021078 | Groundwater Sediment | MSDRPPSRIRQLITLCMLAAAVVTIGLAIAGALTGARSPV |
| Ga0207687_106047912 | 3300025927 | Miscanthus Rhizosphere | MSDRHLTRTNRSITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK |
| Ga0207706_116358651 | 3300025933 | Corn Rhizosphere | MALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK |
| Ga0207670_115351022 | 3300025936 | Switchgrass Rhizosphere | MSERHLTRTGRLMALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK |
| Ga0207669_113697881 | 3300025937 | Miscanthus Rhizosphere | MSARPLSRIRQLIALCMLAAAVVTIGLAIAGALTGARPPAPQLASQK |
| Ga0207704_116783992 | 3300025938 | Miscanthus Rhizosphere | MSDRHLTRIGRLITLCLLLAAVVMIGLAISGALKE |
| Ga0207712_116753011 | 3300025961 | Switchgrass Rhizosphere | MSDRHLTRAGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK |
| Ga0207703_119779551 | 3300026035 | Switchgrass Rhizosphere | RLMALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK |
| Ga0207698_124343832 | 3300026142 | Corn Rhizosphere | MSDRHLTRIGRLITLCLLVAAVVMIGLAISGALKEA |
| Ga0307322_100458832 | 3300028710 | Soil | MSDRPLSHIRQLVALCMLAAAVVTIGLAIAGALTGAQSPVPQLAS |
| Ga0307298_100039791 | 3300028717 | Soil | MSDRPLSHIRQLVALCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0307301_101749052 | 3300028719 | Soil | SHIRQLVALCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0307317_100763551 | 3300028720 | Soil | MSDRPLSRIRQLITLCMLAAAVVTIGLAIAGALTGVQPPVPQLASQK |
| Ga0307317_101797741 | 3300028720 | Soil | DGKLTHIALCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0307317_102985152 | 3300028720 | Soil | MSDRPLSRIRQLITLCMLVAAVVTIGLAIAGALTGARSPVPQLASQK |
| Ga0307316_100267762 | 3300028755 | Soil | MSDRPPSRIRQLITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK |
| Ga0307280_101011252 | 3300028768 | Soil | MSDRPLSHIRQLVALCMLAAAVVTIGLAIAGALTGA |
| Ga0307280_101065071 | 3300028768 | Soil | MSNPHLIRIRQLTALCLLLCAIVTIGLAISGALKEARSPVPQ |
| Ga0307280_103964921 | 3300028768 | Soil | LITLCMLAAAVVTIGLAIAGALTGARSPVPQLASQK |
| Ga0307290_100180701 | 3300028791 | Soil | MSDRPLSRIRQLITLCMLAAAFVTIGLAIAGALTGARPPVPQLASQK |
| Ga0307299_100012506 | 3300028793 | Soil | TALCLLFCAVVIIGLAISGALKEARSPVPQLASHK |
| Ga0307296_107432441 | 3300028819 | Soil | MSDRPLSHIRQLVALCMLAAAVVTIGLAIAGALTGAQSPVPQLA |
| Ga0307289_102531911 | 3300028875 | Soil | LTRIGRLITLCLLLAAVVMIGLAISGALKEARSPVPQLASHK |
| Ga0307286_101979451 | 3300028876 | Soil | TGRLMALCLLVAAVVTIGLAISGAFKRGPSPAPQLASQKK |
| Ga0307277_101039192 | 3300028881 | Soil | MSDRPLSRIRELITLCMLVAAVVTIGLAIAGALPGAR |
| Ga0307308_104953663 | 3300028884 | Soil | QLIALCMLAAAVVTICLAIAGALTGARPPVPQLASQK |
| Ga0307308_104992062 | 3300028884 | Soil | VALCMLAAAVVTIGLAIAGALTGAQSPVPQLASQK |
| Ga0308190_11854112 | 3300030993 | Soil | RIRQLITLCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0170824_1030775821 | 3300031231 | Forest Soil | RRLQSLLDCAGMSDRHLTRIRRLTALCLLFCAVVIIGLAISGALKEARSPVPQLASHK |
| Ga0308194_103218781 | 3300031421 | Soil | SRIRQLITLCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0308179_10409421 | 3300031424 | Soil | HSGANSLVRTMSDRPPSRIRQLITLCMLAAAVVTIGLAIAGALTGARPPVPQLASQK |
| Ga0307468_1008058352 | 3300031740 | Hardwood Forest Soil | VQWIIAKLPMSERHTTRIGRLTALCMLVAAVVTIGLAIAGALKGARAPVPQLASHK |
| Ga0307472_1011905441 | 3300032205 | Hardwood Forest Soil | MSDRHLTRIRQLTALCLLSCAVITIGLAISGALKGARSPVPQLASHK |
| ⦗Top⦘ |