NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090614

Metagenome / Metatranscriptome Family F090614

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090614
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 77 residues
Representative Sequence MLKLFRKVRSWFLPKHEGEFPYSPEGFVKARRWAKNQPHPKLPDHPTQSLWDHVKSNWIDSEYKLNEINKVKTNKNKSI
Number of Associated Samples 90
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 7.41 %
% of genes near scaffold ends (potentially truncated) 24.07 %
% of genes from short scaffolds (< 2000 bps) 69.44 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.852 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(30.556 % of family members)
Environment Ontology (ENVO) Unclassified
(66.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(65.741 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.99%    β-sheet: 1.87%    Coil/Unstructured: 55.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02348CTP_transf_3 20.37
PF01380SIS 5.56
PF05343Peptidase_M42 5.56
PF00132Hexapep 2.78
PF01050MannoseP_isomer 2.78
PF05721PhyH 2.78
PF16363GDP_Man_Dehyd 1.85
PF00291PALP 1.85
PF10431ClpB_D2-small 1.85
PF05050Methyltransf_21 1.85
PF13489Methyltransf_23 1.85
PF00464SHMT 0.93
PF01755Glyco_transf_25 0.93
PF00004AAA 0.93
PF01370Epimerase 0.93
PF13704Glyco_tranf_2_4 0.93
PF01041DegT_DnrJ_EryC1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1083CMP-N-acetylneuraminic acid synthetase, NeuA/PseF familyCell wall/membrane/envelope biogenesis [M] 20.37
COG1212CMP-2-keto-3-deoxyoctulosonic acid synthetaseCell wall/membrane/envelope biogenesis [M] 20.37
COG1861Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase familyCell wall/membrane/envelope biogenesis [M] 20.37
COG1362Aspartyl aminopeptidaseAmino acid transport and metabolism [E] 5.56
COG1363Putative aminopeptidase FrvXCarbohydrate transport and metabolism [G] 5.56
COG2195Di- or tripeptidaseAmino acid transport and metabolism [E] 5.56
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 2.78
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.93
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.93
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.93
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.93
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.93
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.93
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.93
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.93
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.85 %
All OrganismsrootAll Organisms48.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10057473All Organisms → Viruses → Predicted Viral1895Open in IMG/M
3300000115|DelMOSum2011_c10057820Not Available1480Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10011760Not Available2729Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10028250Not Available1610Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10016090All Organisms → Viruses → Predicted Viral3282Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10121281Not Available788Open in IMG/M
3300000947|BBAY92_10200155Not Available520Open in IMG/M
3300001450|JGI24006J15134_10001177All Organisms → cellular organisms → Bacteria15063Open in IMG/M
3300001460|JGI24003J15210_10112494Not Available757Open in IMG/M
3300002483|JGI25132J35274_1109090Not Available558Open in IMG/M
3300004097|Ga0055584_100017580All Organisms → cellular organisms → Bacteria7023Open in IMG/M
3300004448|Ga0065861_1000997All Organisms → cellular organisms → Bacteria2686Open in IMG/M
3300004460|Ga0066222_1014393All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1746Open in IMG/M
3300004461|Ga0066223_1105073All Organisms → cellular organisms → Bacteria2193Open in IMG/M
3300006193|Ga0075445_10042828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1827Open in IMG/M
3300006735|Ga0098038_1009453All Organisms → cellular organisms → Bacteria3844Open in IMG/M
3300006737|Ga0098037_1212689Not Available629Open in IMG/M
3300006793|Ga0098055_1017698All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3087Open in IMG/M
3300006803|Ga0075467_10003182All Organisms → cellular organisms → Bacteria12666Open in IMG/M
3300006916|Ga0070750_10023491All Organisms → Viruses → Predicted Viral3110Open in IMG/M
3300006920|Ga0070748_1000958All Organisms → cellular organisms → Bacteria13678Open in IMG/M
3300007516|Ga0105050_10815044Not Available531Open in IMG/M
3300008470|Ga0115371_10078592Not Available5059Open in IMG/M
3300008470|Ga0115371_10499874All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1495Open in IMG/M
3300008470|Ga0115371_10587335All Organisms → cellular organisms → Bacteria2671Open in IMG/M
3300008470|Ga0115371_10716575Not Available524Open in IMG/M
3300008470|Ga0115371_11108623Not Available1308Open in IMG/M
3300009149|Ga0114918_10090866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1919Open in IMG/M
3300009172|Ga0114995_10000323Not Available32916Open in IMG/M
3300009420|Ga0114994_10128894All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300009420|Ga0114994_10139338Not Available1645Open in IMG/M
3300009428|Ga0114915_1021188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2323Open in IMG/M
3300009436|Ga0115008_10244053All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1279Open in IMG/M
3300009441|Ga0115007_10367572Not Available938Open in IMG/M
3300009526|Ga0115004_10305430Not Available944Open in IMG/M
3300009705|Ga0115000_10769408Not Available592Open in IMG/M
3300009785|Ga0115001_10285958Not Available1048Open in IMG/M
3300010149|Ga0098049_1065750Not Available1148Open in IMG/M
3300010392|Ga0118731_108041726Not Available1083Open in IMG/M
3300010430|Ga0118733_102184607Not Available1099Open in IMG/M
3300010430|Ga0118733_103735088All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium822Open in IMG/M
3300010883|Ga0133547_10218075All Organisms → Viruses → Predicted Viral4042Open in IMG/M
3300012413|Ga0138258_1727725All Organisms → Viruses → Predicted Viral1784Open in IMG/M
3300017697|Ga0180120_10417473Not Available525Open in IMG/M
3300017708|Ga0181369_1107378Not Available576Open in IMG/M
3300017709|Ga0181387_1001600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4709Open in IMG/M
3300017717|Ga0181404_1036128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1260Open in IMG/M
3300017720|Ga0181383_1037452All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300017730|Ga0181417_1043092Not Available1106Open in IMG/M
3300017734|Ga0187222_1115538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium603Open in IMG/M
3300017746|Ga0181389_1063023Not Available1062Open in IMG/M
3300017748|Ga0181393_1093695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium779Open in IMG/M
3300017758|Ga0181409_1027323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1824Open in IMG/M
3300017758|Ga0181409_1038126Not Available1505Open in IMG/M
3300020165|Ga0206125_10057068All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1851Open in IMG/M
3300020253|Ga0211685_1003268Not Available2710Open in IMG/M
3300020317|Ga0211688_1000324Not Available23764Open in IMG/M
3300020352|Ga0211505_1020115All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1727Open in IMG/M
3300020358|Ga0211689_1066942Not Available1037Open in IMG/M
3300020382|Ga0211686_10092753Not Available1232Open in IMG/M
3300021364|Ga0213859_10346889All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium664Open in IMG/M
3300021368|Ga0213860_10272067Not Available742Open in IMG/M
3300021375|Ga0213869_10000596Not Available28700Open in IMG/M
3300021375|Ga0213869_10002501All Organisms → cellular organisms → Bacteria12700Open in IMG/M
3300021375|Ga0213869_10139824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1140Open in IMG/M
3300021378|Ga0213861_10005195All Organisms → cellular organisms → Bacteria10487Open in IMG/M
3300021378|Ga0213861_10049314All Organisms → Viruses → Predicted Viral2713Open in IMG/M
3300024262|Ga0210003_1010450Not Available6402Open in IMG/M
3300025048|Ga0207905_1008023Not Available1895Open in IMG/M
3300025071|Ga0207896_1057691Not Available625Open in IMG/M
3300025102|Ga0208666_1035544Not Available1478Open in IMG/M
3300025127|Ga0209348_1186789Not Available588Open in IMG/M
3300025151|Ga0209645_1009318All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4011Open in IMG/M
3300025276|Ga0208814_1067145Not Available990Open in IMG/M
3300025640|Ga0209198_1055585All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300025892|Ga0209630_10432196All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium560Open in IMG/M
3300027077|Ga0208941_1003287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2534Open in IMG/M
3300027687|Ga0209710_1005566Not Available7903Open in IMG/M
3300027752|Ga0209192_10089458All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300027780|Ga0209502_10203913Not Available908Open in IMG/M
3300027780|Ga0209502_10260048Not Available766Open in IMG/M
3300027788|Ga0209711_10194562Not Available939Open in IMG/M
3300027791|Ga0209830_10070737All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300028194|Ga0257106_1003815All Organisms → cellular organisms → Bacteria6838Open in IMG/M
3300028196|Ga0257114_1052520Not Available1798Open in IMG/M
3300028197|Ga0257110_1334896All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium534Open in IMG/M
3300029787|Ga0183757_1011883All Organisms → cellular organisms → Bacteria2414Open in IMG/M
3300031175|Ga0308020_1057866Not Available1006Open in IMG/M
3300031519|Ga0307488_10012505All Organisms → cellular organisms → Bacteria6874Open in IMG/M
3300031519|Ga0307488_10340297Not Available950Open in IMG/M
3300031519|Ga0307488_10802352Not Available521Open in IMG/M
3300031588|Ga0302137_1250912Not Available593Open in IMG/M
3300031601|Ga0307992_1007652All Organisms → cellular organisms → Bacteria5460Open in IMG/M
3300031601|Ga0307992_1086818All Organisms → Viruses → Predicted Viral1284Open in IMG/M
3300031605|Ga0302132_10349663Not Available676Open in IMG/M
3300031608|Ga0307999_1028168All Organisms → Viruses → Predicted Viral1370Open in IMG/M
3300031627|Ga0302118_10000499All Organisms → Viruses18640Open in IMG/M
3300031631|Ga0307987_1089772Not Available847Open in IMG/M
3300031631|Ga0307987_1135406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.632Open in IMG/M
3300031637|Ga0302138_10088423Not Available1133Open in IMG/M
3300031639|Ga0302117_10272020Not Available668Open in IMG/M
3300031656|Ga0308005_10037064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1279Open in IMG/M
3300031673|Ga0307377_10036982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae4272Open in IMG/M
3300031687|Ga0308008_1035296Not Available1224Open in IMG/M
3300031721|Ga0308013_10168851Not Available821Open in IMG/M
3300031851|Ga0315320_10638650Not Available693Open in IMG/M
3300033742|Ga0314858_063784Not Available909Open in IMG/M
3300033742|Ga0314858_137756Not Available626Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.33%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.33%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.48%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment4.63%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine3.70%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.78%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine2.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.78%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.85%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.85%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.85%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.85%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.93%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.93%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.93%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.93%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020253Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945)EnvironmentalOpen in IMG/M
3300020317Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027077Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031175Marine microbial communities from water near the shore, Antarctic Ocean - #349EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031631Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031639Marine microbial communities from Western Arctic Ocean, Canada - AG5_32.2EnvironmentalOpen in IMG/M
3300031656Marine microbial communities from water near the shore, Antarctic Ocean - #67EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005747353300000101MarineMIKLFRKVRSWFQAKHEGEFPYSPEGFVMAKRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTNKNKTI*
DelMOSum2011_1005782023300000115MarineMDTIHKIIRRVRSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPTLSLWNHVNSNHIDSEYKLSEINKVKTKKNKSI*
SA_S1_NOR05_45mDRAFT_1001176053300000127MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI*
SA_S1_NOR05_45mDRAFT_1002825023300000127MarineMLKLFRKVRSWFQAKHEGEFPYSPEGFVMAKRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTNKNKTI*
SA_S1_NOR08_45mDRAFT_1001609053300000128MarineMIKLIRKVRSWFQTKHEGEFPYSPEGFVNARRWAKNQAHPRLPDHPSQSLWNYVESNWIDSEYKLHEINKVKTKQNKSI*
SA_S1_NOR08_45mDRAFT_1012128113300000128MarineVKHEGEFPYSPEGFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI*
BBAY92_1020015513300000947Macroalgal SurfaceMKYFIKLWRKIKDFFFIDHEGPFGWSPEEFKKAKRWAKNQPHPKFPDHPRMSLWDYVSNNWIDSEYKLHEINKVKTKKKKSI*
JGI24006J15134_10001177203300001450MarineMDIIHKIIRRVSSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPSLSLWNHVNSNHIDSEYKLNEINKVKTKKNKSI*
JGI24003J15210_1011249423300001460MarineMKKFIYKIIRKIKSFFITDHTGPFPYSTDGFIKAKRWAKNQPHPKLPDHPSQSLWNYVSSNWIDSEYKLNEINKVKTNSNKSI*
JGI25132J35274_110909013300002483MarineMFKLLKKIRNWFIPYHEGPFGWSPEEFKKARRWAKNQPHPKFPDHPKMSLWDYVSNNWIDSEYKLNEINKVKTKKKKSI*
Ga0055584_10001758083300004097Pelagic MarineMDIIHKIVRKVKSWFLPKHEGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI*
Ga0065861_100099713300004448MarineMLKLFRKVRSWFLPKHEGEFPYSPEGFVKARRWAKNQPHPKLPDHPTQSLWDHVKSNWIDSEYK
Ga0066222_101439333300004460MarineMLKLFRKVRSWFLPKHEGEFPYSPEGFVKARRWAKNQPHPKLPDHPTQSLWDHVKSNWIDSEYKLNEINKVKTNKNKSI*
Ga0066223_110507313300004461MarineMLKLFRKVRSWFLPKHEGEFPYSPEGFVKARRWAKNQPHPKLPDHPTQSLWDHVKSNWIDSEYKLNEINKVK
Ga0075445_1004282823300006193MarineMFKLFRKIRNWFSPTHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLNEINKVKTNKNKSI*
Ga0098038_100945343300006735MarineMKYIINLWRSIKSFFIIDHKGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDYVNNNWIDSEYKLNEINKVKTKKKKSI*
Ga0098037_121268933300006737MarineFLPKHEGPFGWSPEEFNKARRWAKAQPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI*
Ga0098055_101769823300006793MarineMFKLYRKIRNWFLPKHEGPFGWSPEEFQKARRWAKSHPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI*
Ga0075467_10003182133300006803AqueousMDIIHKIVRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI*
Ga0070750_1002349123300006916AqueousMFKLLKKIKNWFLPVHEGAFGWSPEEFKKARRWSKNQPHPKFPDHPRMSLWDFVDNNFIDSEMKLHEINKVKTKKKKSI*
Ga0070748_100095863300006920AqueousMDIIHKIVRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKNNKSI*
Ga0105050_1081504413300007516FreshwaterMYNLIKKIRWLFLRKQEGAFDYSTEGFIKAKRWAKTQPHPKFPWATAHSLWSYVNRSRVDSEYKLHEINKVKNKVETNKNKTI*
Ga0115371_1007859233300008470SedimentMFKLFRKIRNWFSPIHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLNEINKVKTNKNKSI*
Ga0115371_1049987433300008470SedimentMDFIIKILRKVRSWFLPMHEGEFEYSPEGFTKARRWAKNQPHPHLPDHPSQSLWDYVKSNWIDSEYKLNEINKVKTNKNKTV*
Ga0115371_1058733543300008470SedimentMFNLIRKVKNWFIPKHDEPYGWSPEEFIKARRWAKNQHHPKFPGHPKLSLWDYVNSNWIDSEYKLNEINKVKTKKKKAI*
Ga0115371_1071657513300008470SedimentKMIRLIRKVRSWFLPKHKGNFEYSPEGFVKARRWAKNQPHPRLPDHPSQSLWNYVEGNWIDSEYKLNEINKVKTKRNKSI*
Ga0115371_1110862333300008470SedimentMFNLIKKIRNWFLPNHEGPFEYSPIGFIKAKRWSKNQPHPKFPDHTRYSLWDYVNNNWIDSEYKLHEINKVKTNNNKAI*
Ga0114918_1009086643300009149Deep SubsurfaceMDKRKMIKLIRKVKSWFQVKHEGEFPYSPEGFVKARRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLHEINKVKTNKNKSI*
Ga0114995_10000323333300009172MarineMFKLFKTIKSWFLPNHEGPFPYSTDGFIKAKRWAKNQSHPKLPDHPSQSLWSYVSSNWIDSEYKLNEINKVKTNKNKTI*
Ga0114994_1012889433300009420MarineMFKLFRKVRSWFLPKYEGEFPYSPEGFVNARRWAKNQAHPKLPDHPTQSLWDYVKGNWIDSEYKLHEINKVKTNKNKTI*
Ga0114994_1013933833300009420MarineMFKILKKIRAWFLPKHEGEFSYSPEGFVMARRWAKNQPHPKLPDHPTQSLWNYVESNWIDSEYKLNEINKVKTNKNKSI*
Ga0114915_102118833300009428Deep OceanMIRLIRKVRSWFLPKHKGNFEYSPEGFVKARRWAKNQPHPRLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKRNKSI*
Ga0115008_1024405323300009436MarineMDILHKIVRKVKSWFLPKHEGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI*
Ga0115007_1036757223300009441MarineMIKLIRKVRSWFQVKHEGEFPYSPEAFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLHEINKVKTKQNKSI*
Ga0115004_1030543023300009526MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFVKAKRWAKNQPHPYIQNQSLWSFVDSGWIDSEHILNEINKVKTNKNKSI*
Ga0115000_1076940813300009705MarineMIKLIRKVRSWFQTKHEGEFPYSPEGFVNARRWAKNQAHPRLPDHPSQSLWDYVESNWIDSEYKLHEINKVKTKQNKSI*
Ga0115001_1028595823300009785MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFLKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI*
Ga0098049_106575013300010149MarinePKHEGPFGWSPEEFQKARRWAKSHPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI*
Ga0118731_10804172633300010392MarineIRKIKSFFITDHTGPFPYSTDGFIKAKRWAKNQPHPKLPDHPSQSLWNYVSSNWIDSEYKLNEINKVKTNSNKSI*
Ga0118733_10218460723300010430Marine SedimentMKKFIYKVIRKIKSFFITDHTGPFPYSTDGFIKAKRWAKNQPHPKLPDHPSQSLWNYVSSNWIDSEYKLNEINKVKTNSNKSI*
Ga0118733_10373508823300010430Marine SedimentMDIIHKIVRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNK
Ga0133547_1021807513300010883MarineKNIMFKILKKIRAWFLPKHEGEFSYSPEGFVMARRWAKNQPHPKLPDHPTQSLWNYVESNWIDSEYKLNEINKVKTNKNKSI*
Ga0138258_172772523300012413Polar MarineMIHKLIRKIKNWFLPKHEGEFKYSPEGFVKAMRWSKNQLHPKFPNHPRLSLWDYVNNNWIDSEFKLHEINKVKTNKNKTI*
Ga0180120_1041747323300017697Freshwater To Marine Saline GradientMDTIHKIIRRVRSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPTLSLWNHVNSNHIDSEYKLSEINKVK
Ga0181369_110737813300017708MarineKIRNWFLPKHEGPFGWSPEEFQKARRWAKSHPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI
Ga0181387_100160023300017709SeawaterMKLIRLIKSWFLPKHKGAFEYSPTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVQSNWIDSEYKLSEINKVKTGKK
Ga0181404_103612823300017717SeawaterMKLIRLIKSWFLPKHKGAFEYSPTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVQSNWIDSEYKLSEINKVKNNKKKRKLIIQIL
Ga0181383_103745223300017720SeawaterMKLIRLIKSWFLPKHKGAFEYSSTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVQSNWIDSEYKLSEINKVKTGKK
Ga0181417_104309213300017730SeawaterIINLWRSIKSFFIIDHKGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDYVNNNWIDSEYKLNEINKVKTKKKKSI
Ga0187222_111553823300017734SeawaterMKLIRLIKSWFLPKHKGAFEYSPTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVQSNWIDSEYKLSEINK
Ga0181389_106302333300017746SeawaterMDIIHKIIKRVRSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPSLSLWNHVNSNHIDSEYKLNEINKVKTKKNKSI
Ga0181393_109369523300017748SeawaterMKLIRLIKSWFLPKHKGAFEYSSTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVESNWIDSEYKLSEINKVKTGKK
Ga0181409_102732323300017758SeawaterMDIIHKIIRRVRSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPSLSLWNHVNSNHIDSEYKLNEINKVKTKKNKSI
Ga0181409_103812623300017758SeawaterMKYIINLWRSIKNFFIIDHKGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDYVNNNWIDSEYKLNEINKVKTKKKKSI
Ga0206125_1005706833300020165SeawaterMDIIHKIVRKVKSWFLPKHEGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI
Ga0211685_100326813300020253MarineMFKLFRKIRNWFSPIHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLNEINKVKTNKNKSI
Ga0211688_1000324163300020317MarineMDIIHKIVRKVKSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI
Ga0211505_102011533300020352MarineMFKLYRKIRNWFLPKHEGPFGWSPEEFQKARRWAKSHPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI
Ga0211689_106694223300020358MarineMFKLFRKVRSWFLPKHEGEFPYSPEGFVKARRWAKNQAHPKLPDHPTQSLWDYVKSNWIDSEYKLNEINKVKTNKNKPI
Ga0211686_1009275333300020382MarineMIMFNLIKKIRNWFLPNHEGPFDYSPVGFIKAKRWSKNQPHPKFPDHTRYSLWDYVNNNWIDSEYKLHEINKVKTNNNKAI
Ga0213859_1034688923300021364SeawaterMFKLLKKIKNWFLPVHEGAFGWSPEEFKKARRWSKNQPHPKFPDHPRMSLWDFVDNNFIDSEMKLHEINKVKTKKKKSI
Ga0213860_1027206733300021368SeawaterKHEGLFGWSPEEFVKARRWAKTQPHPTVPQLSLWDFVNSNHIDSEYKLNEINKVKQNSKSTI
Ga0213869_10000596423300021375SeawaterMDTIHKIIRRVRSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPTLSLWNHVNSNHIDSEYKLSEINKVKTKKNKSI
Ga0213869_10002501113300021375SeawaterMDIIHKIVRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI
Ga0213869_1013982423300021375SeawaterMMKLIRLIKSWFLPKHKGAFEYSSTGFKKAKRWAKNQPHPNLPDHPSISLWDYVESNWIDSEYKLSEINKVKTGKK
Ga0213861_1000519523300021378SeawaterMDIIHKIVRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKNNKSI
Ga0213861_1004931413300021378SeawaterRKVKSWFLPKHKGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKNKSI
Ga0210003_101045093300024262Deep SubsurfaceMIKLIRKVKSWFQVKHEGEFPYSPEGFVKARRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLHEINKVKTKQNKSI
Ga0207905_100802323300025048MarineMDIIHKIIRRVSSWFLPKHEGKFEYSPEGFVKARRWAKNQPHPKFPDHPSLSLWNHVNSNHIDSEYKLNEINKVKTKKNKSI
Ga0207896_105769123300025071MarineMKKFIYKIIRKIKSFFITDHTGPFPYSTDGFIKAKRWAKNQPHPKLPDHPSQSLWNYVSSNWIDSEYKLNEINKVKTNSNKSI
Ga0208666_103554443300025102MarineMKYIINLWRSIKSFFIIDHKGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDYVNNNWIDSEYKLNEINKVKTKKKKSI
Ga0209348_118678923300025127MarineMFKLLKKIKGWFIPTHDGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDHVENNHYDSEMKLHKINEVKTKKKKSI
Ga0209645_100931863300025151MarineMFKLLKKIRNWFIPYHEGPFGWSPEEFKKARRWAKNQPHPKFPDHPKMSLWDYVSNNWIDSEYKLNEINKVKTKKKKSI
Ga0208814_106714523300025276Deep OceanMIRLIRKVRSWFLPKHKGNFEYSPEGFVKARRWAKNQPHPRLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKRNKSI
Ga0209198_105558513300025640Pelagic MarineMDIIHKIVRKVKSWFLPKHEGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKVKTKKKVIKNIRLNIFF
Ga0209630_1043219623300025892Pelagic MarineMDIIHKIVRKVKSWFLPKHEGKFEYSPEGFVKAKRWAKNQPHPKFPDHPSLSLWDHVNSNHIDSEYKLSEINKSGNYRVRKKFL
Ga0208941_100328743300027077MarineMKLIRLIKSWFLPKHKGAFEYSPTGFKKAKRWAKNQPHPNLPDHPSVSLWDYVQSNWIDSEYKLSEINKVKNNKKKRK
Ga0209710_100556693300027687MarineMFKLFKTIKSWFLPNHEGPFPYSTDGFIKAKRWAKNQSHPKLPDHPSQSLWSYVSSNWIDSEYKLNEINKVKTNKNKTI
Ga0209192_1008945813300027752MarineMLKLFRKVRSWFQAKHEGEFPYSPEGFVMAKRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTNKNKTI
Ga0209502_1020391323300027780MarineMFKILKKIRAWFLPKHEGEFSYSPEGFVMARRWAKNQPHPKLPDHPTQSLWNYVESNWIDSEYKLNEINKVKTNKNKSI
Ga0209502_1026004813300027780MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKV
Ga0209711_1019456233300027788MarineMIKLFRKVRSWFQAKHEGEFPYSPEGFVMAKRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTNKNKTI
Ga0209830_1007073743300027791MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI
Ga0257106_100381593300028194MarineMFKLFRTIRSWFLPKHKGAFPYSTDGFIKAKRWAKTQPHPKLPDHPSQSLWNYVSSNWIASEYKLNEINKVKTNKNKTI
Ga0257114_105252013300028196MarineLPKHIGTFSWSPGDFVKARRWAKTQPHPSVPQLTLWDFVDSGWIDSEYKLNEINKVKTIKDKSI
Ga0257110_133489613300028197MarineMIKILRKIRSWFLPKHKGVFEYSPEGFVKARRWAKNQPHPKLPDHPTQSLWDYVKSNWIDSEYKLNEINKIKTNQNKTV
Ga0183757_101188343300029787MarineMLKLMKILRNWIPSIHEGPFEYSSEGFTKARRWAKNQDHPKFPGHPRLSLWDYVNDNFIDSEHKLNEINKVKTKKKNYI
Ga0308020_105786613300031175MarineIHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLNEINKVKTNKNKSI
Ga0307488_1001250543300031519Sackhole BrineMFKLFRKVRSWFLPKYEGEFPYSPEGFVNARRWAKNQAHPKLPDHPTQSLWDYVKGNWIDSEYKLHEINKVKTNKNKTI
Ga0307488_1034029723300031519Sackhole BrineMFKIIRKVKSWFLPIHKGEFPYSPEGFVMARRWAKNQPHPNFPDQHSQSLWDYVKSSWIDSEYKLNEINKVKTNKNKTI
Ga0307488_1080235223300031519Sackhole BrineMIKLIRKVRSWFQVKHEGKFPYSPEGFVKAKRWAKNQPHPYIQNQSLWSFVDSGWIDSEHILNEINKVKTNKNKSI
Ga0302137_125091223300031588MarineMFKLFKTIKSWFLPNHEGPFPYSTDGFIKAKRWAKNQSHPKLPDHPSQSLWSYVSSNWIDSEYKLN
Ga0307992_100765253300031601MarineMVKLIRKVKSWFLPVHDGEFPYSPEGFVKAKRWAKNQPHPYIKNQSLWSFVESNWIDSEYKLNEINKVKTNQNKSI
Ga0307992_108681823300031601MarineMFNLIRKAKNWFTPKHNGPYGWSPEEFTKARRWAKNQPHPEHPRWSLWDYVDSNWIDSEYKLNEINKVKTNKKKAI
Ga0302132_1034966313300031605MarineMFKLFRKVRSWFLPKYEGEFPYSPEGFVNARRWAKNQAHPKLPDHPTQSLWDYVKGNWIDSEYKLHEINKVKTNKNK
Ga0307999_102816833300031608MarineMIMFNLIKKIRNWFLPNHEGPFEYSPIGFIKAKRWSKNQPHPKFPDHTRYSLWDYVNNNWIDSEYKLHEINKVKTNNNKAI
Ga0302118_1000049953300031627MarineMIKLIRKVRSWFQVKHEGEFPYSPEGFLKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI
Ga0307987_108977213300031631MarineMFNLIKKIRGWFLRKHEGEFEYSPEGFVKAKRWAKTQLHPNDQATYSQSLWSYVNGNWIDSEYKLHEINKVKTNKNKAI
Ga0307987_113540623300031631MarineMFNLIRKAKNWFAPKHDGAYGWSPEEFTKARRWAKNQPHPEHPRWSLWDYVDSNWIDSEYKLNEINKVKTNKKKAI
Ga0302138_1008842313300031637MarineWFQPKCEGPFPYSTDGFVNAKRWAKTQSHPKLPDHPSQSLWDYVSSNWIDSEYKLNEINKVKTNSNKSI
Ga0302117_1027202033300031639MarineMFKLLRKVRSWFLPKYEGEFPYSPEGFVNARRWAKNQPHPKLPDHPTQSLWDYVKGNWIDSEYKLHEINKVKTNKNKTI
Ga0308005_1003706413300031656MarineMFKLFRKIRNWFSPTHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLNEIN
Ga0307377_1003698263300031673SoilMIKLIRKVKSWFQTKHEGEFPYSPEGFVKARRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLHEINKVKTKKNKSI
Ga0308008_103529633300031687MarineMFKLFRKIRNWFSPTHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWIDSEYKLN
Ga0308013_1016885113300031721MarineMFKLFRKIRNWFSPTHHGPFPYSTKGFTKAKRWAKNQNHPKLPDHPTQSLWDYVSSNWI
Ga0315320_1063865013300031851SeawaterMKYIINLWRSIKSFFIIDHKGPFGWSPEEFKKARRWAKNQPHPKFPDHPRMSLWDYVNNNWIDSEYKLNEINKVKTKKK
Ga0314858_063784_93_3323300033742Sea-Ice BrineMIKLIRKVRSWFQIKHEGEFPYSPEGFVKAKRWAKNQPHPKLPDHPSQSLWNYVESNWIDSEYKLNEINKVKTKQNKSI
Ga0314858_137756_426_6263300033742Sea-Ice BrineMIKLFRKVRSWFQAKHEGEFPYSPEGFVMAKRWAKNQAHPKLPDHPSQSLWNYVESNWIDSEYKLNE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.