NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090538

Metagenome / Metatranscriptome Family F090538

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090538
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence MRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDIITGI
Number of Associated Samples 97
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.04 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 96.30 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.259 % of family members)
Environment Ontology (ENVO) Unclassified
(37.963 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.074 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.19%    β-sheet: 14.49%    Coil/Unstructured: 62.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00733Asn_synthase 81.48
PF04464Glyphos_transf 7.41
PF13537GATase_7 6.48
PF01882DUF58 0.93
PF08666SAF 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1887CDP-glycerol glycerophosphotransferase, TagB/SpsB familyCell wall/membrane/envelope biogenesis [M] 7.41
COG1721Uncharacterized conserved protein, DUF58 family, contains vWF domainFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c1989801All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300001686|C688J18823_10131566All Organisms → cellular organisms → Bacteria → Acidobacteria1726Open in IMG/M
3300005179|Ga0066684_10276476All Organisms → cellular organisms → Bacteria → Acidobacteria1110Open in IMG/M
3300005329|Ga0070683_100777890All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300005332|Ga0066388_100080834All Organisms → cellular organisms → Bacteria3621Open in IMG/M
3300005332|Ga0066388_101713619All Organisms → cellular organisms → Bacteria → Acidobacteria1113Open in IMG/M
3300005338|Ga0068868_100213574All Organisms → cellular organisms → Bacteria → Acidobacteria1613Open in IMG/M
3300005343|Ga0070687_101004272All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300005364|Ga0070673_102124073All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300005364|Ga0070673_102144672All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300005529|Ga0070741_11664501All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005544|Ga0070686_101024967All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300005568|Ga0066703_10159312All Organisms → cellular organisms → Bacteria → Acidobacteria1358Open in IMG/M
3300005616|Ga0068852_101952187All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300005617|Ga0068859_100105261All Organisms → cellular organisms → Bacteria2881Open in IMG/M
3300005719|Ga0068861_100721954All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300005764|Ga0066903_101989601All Organisms → cellular organisms → Bacteria → Acidobacteria1116Open in IMG/M
3300005764|Ga0066903_102514385All Organisms → cellular organisms → Bacteria → Acidobacteria997Open in IMG/M
3300005829|Ga0074479_10543459All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300005844|Ga0068862_102633291All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300006059|Ga0075017_101220104All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300006237|Ga0097621_100682850All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300006580|Ga0074049_11396537All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300006852|Ga0075433_11461855All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300006853|Ga0075420_101839142All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300006854|Ga0075425_101447854All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300006871|Ga0075434_102471685All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300006904|Ga0075424_102101717All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300006914|Ga0075436_100749082All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300009089|Ga0099828_10694950All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300009156|Ga0111538_10444164All Organisms → cellular organisms → Bacteria → Acidobacteria1644Open in IMG/M
3300009156|Ga0111538_11220438All Organisms → cellular organisms → Bacteria → Acidobacteria950Open in IMG/M
3300010303|Ga0134082_10024962All Organisms → cellular organisms → Bacteria → Acidobacteria2223Open in IMG/M
3300010320|Ga0134109_10499704All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300010358|Ga0126370_10998273All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300010359|Ga0126376_11051720All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300010397|Ga0134124_10258148All Organisms → cellular organisms → Bacteria → Acidobacteria1606Open in IMG/M
3300010400|Ga0134122_10410097All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300010401|Ga0134121_10240197All Organisms → cellular organisms → Bacteria → Acidobacteria1582Open in IMG/M
3300010401|Ga0134121_11994658All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300011444|Ga0137463_1196922All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300012096|Ga0137389_10524982All Organisms → cellular organisms → Bacteria → Acidobacteria1016Open in IMG/M
3300012207|Ga0137381_11249999All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300012232|Ga0137435_1261039All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300012353|Ga0137367_10637560All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300012362|Ga0137361_10412057All Organisms → cellular organisms → Bacteria → Acidobacteria1241Open in IMG/M
3300012925|Ga0137419_10003285All Organisms → cellular organisms → Bacteria7666Open in IMG/M
3300012961|Ga0164302_11114180All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300012971|Ga0126369_11107271All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300012971|Ga0126369_12099917All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300012987|Ga0164307_11783477All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300013296|Ga0157374_11074686All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300013296|Ga0157374_11516621All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300013306|Ga0163162_11964899All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300013308|Ga0157375_12895139All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300013308|Ga0157375_13166915All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300014968|Ga0157379_12496430All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300014969|Ga0157376_12075878All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300015077|Ga0173483_10656303All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300015357|Ga0134072_10115351All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300015372|Ga0132256_103812678All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300018056|Ga0184623_10143465All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300018422|Ga0190265_10246246All Organisms → cellular organisms → Bacteria → Acidobacteria1831Open in IMG/M
3300018476|Ga0190274_12823684All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300019362|Ga0173479_10542179All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300020580|Ga0210403_11130031All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300021861|Ga0213853_11500581All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300025862|Ga0209483_1305371All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300025906|Ga0207699_11477994All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300025922|Ga0207646_11215089All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300025926|Ga0207659_10976355All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300025935|Ga0207709_11124487All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300025941|Ga0207711_10392548All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300025942|Ga0207689_11082169All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300025944|Ga0207661_10736259All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300025960|Ga0207651_11584788All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300025986|Ga0207658_10256857All Organisms → cellular organisms → Bacteria → Acidobacteria1487Open in IMG/M
3300025986|Ga0207658_12032518All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300026035|Ga0207703_11002868All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300026075|Ga0207708_10192441All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300026088|Ga0207641_11631402All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300026089|Ga0207648_10303920All Organisms → cellular organisms → Bacteria → Acidobacteria1431Open in IMG/M
3300026304|Ga0209240_1081031All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300026304|Ga0209240_1266305All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300026309|Ga0209055_1287350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300026310|Ga0209239_1098907All Organisms → cellular organisms → Bacteria → Acidobacteria1240Open in IMG/M
3300026527|Ga0209059_1051708All Organisms → cellular organisms → Bacteria → Acidobacteria1805Open in IMG/M
3300026540|Ga0209376_1123090All Organisms → cellular organisms → Bacteria → Acidobacteria1285Open in IMG/M
3300027821|Ga0209811_10072900All Organisms → cellular organisms → Bacteria → Acidobacteria1203Open in IMG/M
3300027907|Ga0207428_10721078All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300027909|Ga0209382_11030206All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300028379|Ga0268266_11029205All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300028380|Ga0268265_12412740All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300028792|Ga0307504_10237215All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300028828|Ga0307312_10384740All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300031226|Ga0307497_10504694All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300031240|Ga0265320_10462051All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300031544|Ga0318534_10078718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1872Open in IMG/M
3300031740|Ga0307468_101055094All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300032000|Ga0310903_10280039All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300032002|Ga0307416_100567119All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300032076|Ga0306924_11955316All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300032180|Ga0307471_104218248All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300032205|Ga0307472_102423966All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300032211|Ga0310896_10598822All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300032261|Ga0306920_100729960All Organisms → cellular organisms → Bacteria → Acidobacteria1458Open in IMG/M
3300032261|Ga0306920_104249691All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300032954|Ga0335083_10900390All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.93%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_198980123300000033SoilVRVTMLLRCLGMMHGGGETRHLAWARXLXRAGXXVTXVTGRPLFGAT
C688J18823_1013156623300001686SoilVRVTMLVRCLAMMRGGGETRHLAWARELTSLGVHVRIVTG
Ga0066684_1027647623300005179SoilMRVTMLVRCLAMMRGGGETRHLAWMRELAALGVDVDVIAGEPW
Ga0070683_10077789013300005329Corn RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVRIIAG
Ga0066388_10008083443300005332Tropical Forest SoilMLLRCLGMMHGGGETRHLAWARELQRAGDEVTIVTGRPLLA
Ga0066388_10171361913300005332Tropical Forest SoilMMLRCLGMMRGGGETRHIAWMRELDAMGVDVEVITGGPLFGAMRY
Ga0068868_10021357413300005338Miscanthus RhizosphereMVLRCLTMMHGGGETRHLAWARELRAAGDDVTMITGRPLLARPRHA
Ga0070687_10100427223300005343Switchgrass RhizosphereVRVTILLRCLSMMHGGGETRHLAWARELQRAGDDVTIVTGRPLFA
Ga0070673_10212407323300005364Switchgrass RhizosphereMRVTMLVRCLAMMHGGGETRHLAWMKELAALGVEVDVIAGRPLV
Ga0070673_10214467213300005364Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELDALGVEVDVITGQPL
Ga0070741_1166450113300005529Surface SoilMRVTMLVRCLAMMRGGGETRHLAWARELAALGVEV
Ga0070686_10102496713300005544Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELANLGVDVDVITGQPL
Ga0066703_1015931213300005568SoilMRVTMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGA
Ga0068852_10195218713300005616Corn RhizosphereMMLRCLGMMRGGGETRHLAWMRELTAMGVDVEVITGG
Ga0068859_10010526113300005617Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDII
Ga0068861_10072195423300005719Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELTALGVDVDVITGEPLWLGGL
Ga0066903_10198960123300005764Tropical Forest SoilVRVTMLVRCLSMMHGGGETRHLAWARALRSAGDEVTIITGRPLFAPARYQTDDG
Ga0066903_10251438513300005764Tropical Forest SoilMFVRCLAMMRGGGETRHLAWARELIAAGVDVDIVTGRPFLLGRP
Ga0074479_1054345913300005829Sediment (Intertidal)MLLRCLGMMRGGGETRHMAWMRELTGMGVEVEVITGGPLFGDMRY
Ga0068862_10263329113300005844Switchgrass RhizosphereMRVTYLMRCLAMMRGGGETQHLAWMRALVRAGVEVQIIS
Ga0075017_10122010423300006059WatershedsMLLRCLGMMRGGGETRHMAWMRELDAMGVEVEVITGGPLFG
Ga0097621_10068285013300006237Miscanthus RhizosphereMRVSMLVRCLAMMWGGGETRHLEWARELTALGVEVEIITGVPLS
Ga0074049_1139653713300006580SoilMRVTMLVRCLAMMRGGGETRHLAWARELSALGVDVEIVLGVPLVSGRGRY
Ga0075433_1146185513300006852Populus RhizosphereMLVRCLAMMRGGGETRHLAWARELAALGVEVDIIAGRPLLFGG
Ga0075420_10183914223300006853Populus RhizosphereVRVTILLRCLSMMHGGGETRHLAWARELRRAGDEVTIVTGRPLFAP
Ga0075425_10144785423300006854Populus RhizosphereVRVTMLLRCLGMMHGGGETRHLAWARELRRAGDEVTIITGR
Ga0075434_10247168513300006871Populus RhizosphereVRVTMLVRCLAMMRGGGETRHLAWARELRALGVDVDII
Ga0075424_10210171723300006904Populus RhizosphereVRITFVLRCLTMMHGGGETRHLAWARELRAAGDDVT
Ga0075436_10074908213300006914Populus RhizosphereMRVTMLVRCLAMMHGGGETRHLAWARELASLGVEVDIIAGRPL
Ga0099828_1069495013300009089Vadose Zone SoilMRVTMLVRCLAMMRGGGETRHLAWAKELTALGVDVE
Ga0111538_1044416413300009156Populus RhizosphereVRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPL
Ga0111538_1122043823300009156Populus RhizosphereVRVTYLMRCLAMMRGGGETQHLAWMRALAKLGVEID
Ga0134082_1002496213300010303Grasslands SoilMRVTMLVRCLAMMRGGGETRHLAWARELAALGADV
Ga0134109_1049970413300010320Grasslands SoilMRVTMLVLCLAMMRGGGETRHLAWMRELDALGVEVDVIAGRPLM
Ga0126370_1099827313300010358Tropical Forest SoilMMLRCLGMMRGGGETRHIAWMREFDAMGVDVEVIT
Ga0126376_1105172013300010359Tropical Forest SoilMKVTYFMRCLAMMRGGGETQHLAWIRALRGMGVEIDIITGRP
Ga0134124_1025814813300010397Terrestrial SoilMRVTMLVRCLAMMRGGGETRHLAWARELHALGVDVEIIT
Ga0134122_1041009713300010400Terrestrial SoilVRVTMLVRCLAMMRGGGETRHLAWAHELSALGVEVDII
Ga0134121_1024019713300010401Terrestrial SoilMRVIMLVRCLAMMRGGGETRHLAWARELSALGVDVEVITGVPLLGAA
Ga0134121_1199465823300010401Terrestrial SoilMLVRCLAMMRGGGETRHLAWARELTALGVDVEMITGAPL
Ga0137463_119692223300011444SoilMRVTMLVRCLAMMRGGGETRHLAWARELGALGVDVEI
Ga0137389_1052498223300012096Vadose Zone SoilVRVTMLVRCLAMMRGGGETRHLAWARELTALGVSVEIIAGRPLLFGG
Ga0137381_1124999913300012207Vadose Zone SoilMLVRCLAMMRGGGETRHLAWARELAAMGVDVDIITGAPLF
Ga0137435_126103913300012232SoilVALVRVTYLMRCLGMMRGGGETQHLAWMRTLKGMGVEIEVISGRP
Ga0137367_1063756013300012353Vadose Zone SoilMRVTMLVRCLAMMRGGGEMRHLAWARELTSMGVRVEIIAGRPLLV
Ga0137361_1041205713300012362Vadose Zone SoilMRVTMLVRCLAMMRGGGETRHLAWARELAALGADVDIIAGRPLLL
Ga0137419_1000328513300012925Vadose Zone SoilVRVTMLVRCLAMMRGGGETRHLAWARELTALGVSVEIIAGR
Ga0164302_1111418023300012961SoilVRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAP
Ga0126369_1110727123300012971Tropical Forest SoilMLLRCLGMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAHARQPLD
Ga0126369_1209991723300012971Tropical Forest SoilVRVTMFVRCLAMMRGGGETRHLAWAHELTALGVEVDIITGAPLFGE
Ga0164307_1178347713300012987SoilMMRGGGETRHLAWARELTALGVDVRIVTGVPLVSGEVRYPID
Ga0157374_1107468613300013296Miscanthus RhizosphereMMLRCLGMMRGGGETRHLAWMRELRARGVDVEVISG*
Ga0157374_1151662113300013296Miscanthus RhizosphereMRVTMRVRCLAMMLGGGGTRHLAWMKELAALGVEVDVIAGRPLV
Ga0163162_1196489923300013306Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELTALGVDIEIIAG
Ga0157375_1289513923300013308Miscanthus RhizosphereVRVTMLVRCLSMMHGGGETRHLAWAQALRLAGHAVTIITG
Ga0157375_1316691513300013308Miscanthus RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVDFITGRPLLFGQ
Ga0157379_1249643013300014968Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELGALGVEVDVITGQPLMLG
Ga0157376_1207587813300014969Miscanthus RhizosphereMRVTMLVRCLAMMHGGGETRHLAWMKELAALGVDVDVIA
Ga0173483_1065630323300015077SoilMRVTMLVRCLAMMRGGGETRHLAWMRELTALGVEVDVIT
Ga0134072_1011535113300015357Grasslands SoilMRVTMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAPL
Ga0132256_10381267813300015372Arabidopsis RhizosphereMRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLF
Ga0184623_1014346523300018056Groundwater SedimentMRVTMLVRCLAMMRGGGETRHLAWARERTSLGVDVHVIA
Ga0190265_1024624613300018422SoilVRVTYLMRCLAMMRGGGETQHLAWMRALTRLGVEIEVI
Ga0190274_1282368423300018476SoilMRVAMLVRCLAMMRGGGETRHLAWARELGALGVDVEIVTGRPLLGAHRYA
Ga0173479_1054217913300019362SoilMRVTMLVRCLAMMRGGGETRHLAWMRELTAMGVEVDVITGQPLLLGGARF
Ga0210403_1113003123300020580SoilMRVTMLVRCLAMMRGGGETRHLAWMRELESLGVEVD
Ga0213853_1150058123300021861WatershedsMRVTMLLRCLAMMRGGGETRHLAWARELTALGVEVD
Ga0209483_130537123300025862Arctic Peat SoilVCSQRDSVRVTMMLRCLGMMRGGGETRHLAWIRELDAMGVDVEVITG
Ga0207699_1147799423300025906Corn, Switchgrass And Miscanthus RhizosphereMKVTMLLRCLAMMRGGGETRHMAWMRELAAMGVEVEVITGGPLFGQMRYS
Ga0207646_1121508923300025922Corn, Switchgrass And Miscanthus RhizosphereVTMLVRCLAMMRGGGETRHLAWARELTALGVEVEIIAG
Ga0207659_1097635513300025926Miscanthus RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELTALGVEVDVI
Ga0207709_1112448723300025935Miscanthus RhizosphereVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGR
Ga0207711_1039254813300025941Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELAALGVDVDVITGAPLWLG
Ga0207689_1108216913300025942Miscanthus RhizosphereMRVTMLVRCLAMMRGGGETRHLAWMRELDALGVEVDVITGQPLMIGG
Ga0207661_1073625923300025944Corn RhizosphereMILRCLAMMRGGGETRHMAWMRELAAMGVDVDVITGGPLFGDMRY
Ga0207651_1158478833300025960Switchgrass RhizosphereVRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVEIIA
Ga0207658_1025685713300025986Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDIITGI
Ga0207658_1203251823300025986Switchgrass RhizosphereVTMLVRCLAMMHGGGETRHLAWMKELAALGVEVDVIAGRPLVLG
Ga0207703_1100286833300026035Switchgrass RhizosphereVRVTMLVRCLAMMRGGGETRHLAWARELTMLGVHVDIITGAPLVGAAR
Ga0207708_1019244113300026075Corn, Switchgrass And Miscanthus RhizosphereMRVTMLVRCLAMMRGGGETRHLAWAQELSAMGVEVEIITGGPLL
Ga0207641_1163140213300026088Switchgrass RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELGALGVDVEIITGVPLV
Ga0207648_1030392013300026089Miscanthus RhizosphereMRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVDF
Ga0209240_108103133300026304Grasslands SoilMRVTMFIRCLAMMRGGGETRHLAWIRELSLLGVEVDVV
Ga0209240_126630513300026304Grasslands SoilVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDVITGVPLVSGEAR
Ga0209055_128735023300026309SoilMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVT
Ga0209239_109890713300026310Grasslands SoilMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAPLLGQPRYPL
Ga0209059_105170823300026527SoilMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAP
Ga0209376_112309013300026540SoilVRVTMLVRCLAMMRGGGETRHLAWARELQSLGVSVELV
Ga0209811_1007290023300027821Surface SoilMLVRCLAMMRGGGETRHLAWARELAAMGVDVDIIAGRPLLFGGP
Ga0207428_1072107813300027907Populus RhizosphereVRVTILLRCLSMMHGGGETRHLAWARELRRAGDEVTIVTGRPLFAPARF
Ga0209382_1103020623300027909Populus RhizosphereVRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLF
Ga0268266_1102920523300028379Switchgrass RhizosphereMRVTYLMRCLAMMRGGGETQHLAWMRGLRAQGVEI
Ga0268265_1241274023300028380Switchgrass RhizosphereVRVTYLMRCLAMMRGGGETQHLAWMRALIGMGIEIDII
Ga0307504_1023721513300028792SoilMRVTMLVRCLAMMRGGGETRHLAWMRELSALGIDVDVITGRPLLVGRLRH
Ga0307312_1038474013300028828SoilMRVTMLVRCLAMMRGGGETRHLAWMKELAALGVEVDVITGRPL
Ga0307497_1050469423300031226SoilMRVTMLVRCLAMMHGGGETRHLAWMKDLAALGADVDVIAGRPLL
Ga0265320_1046205123300031240RhizosphereVTMMLRCLGMMRGGGETRHLAWIHELEAMGVDVEVITGGP
Ga0318534_1007871813300031544SoilVRVTMLVRCLSMMHGGGETRHLAWARALRSAGDEVTIIT
Ga0307468_10105509423300031740Hardwood Forest SoilVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAPAR
Ga0310903_1028003923300032000SoilMLVRCLAMMRGGGETRHLAWARELVAAGVNVDIIT
Ga0307416_10056711913300032002RhizosphereVRVTMLLRCLGMMHGGGETRHLAWARELQRAGDEV
Ga0306924_1195531623300032076SoilMRVTMLVRCLAMMRGGGETRHLAWARELTRLGIDVELVAGRPL
Ga0307471_10421824813300032180Hardwood Forest SoilMLVRCLAMMRGGGETRHLAWARELTALGVDVEIITGAPLFGEARY
Ga0307472_10242396613300032205Hardwood Forest SoilMRVTMLVRCLAMMRGGGETRHLAWARELVALGVDVDI
Ga0310896_1059882223300032211SoilVRVTMLLRCLGMMHGGGETRHLAWARELQRAGDRVTI
Ga0306920_10072996023300032261SoilMLVRCLAMMRGGGETRHLAWAHELSALGVDVDILAGRPLLFGG
Ga0306920_10424969113300032261SoilMMLRCVAMMRGGGETQHLAWIRELLAMGVDVELITG
Ga0335083_1090039013300032954SoilMMLRCLGMMRGGGETRHIAWMRELDAMGVDVEVITGGPLFGAMRYAVR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.