Basic Information | |
---|---|
Family ID | F090519 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 46 residues |
Representative Sequence | MSAVQKFIASARKLHAEETDPAKRWEKMTPLLQELLADPSVKEQSK |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 98.13 % |
% of genes near scaffold ends (potentially truncated) | 94.44 % |
% of genes from short scaffolds (< 2000 bps) | 88.89 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.222 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.185 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.037 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.259 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF05221 | AdoHcyase | 36.11 |
PF00670 | AdoHcyase_NAD | 25.00 |
PF12773 | DZR | 2.78 |
PF14213 | DUF4325 | 1.85 |
PF14076 | DUF4258 | 1.85 |
PF04909 | Amidohydro_2 | 0.93 |
PF00581 | Rhodanese | 0.93 |
PF02630 | SCO1-SenC | 0.93 |
PF06835 | LptC | 0.93 |
PF02482 | Ribosomal_S30AE | 0.93 |
PF00702 | Hydrolase | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 61.11 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.22 % |
All Organisms | root | All Organisms | 27.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459016|G1P06HT01EXYXP | Not Available | 637 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14580079 | Not Available | 832 | Open in IMG/M |
3300000890|JGI11643J12802_11872225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1120 | Open in IMG/M |
3300000956|JGI10216J12902_105633481 | Not Available | 615 | Open in IMG/M |
3300003996|Ga0055467_10114899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300004019|Ga0055439_10036156 | Not Available | 1281 | Open in IMG/M |
3300004070|Ga0055488_10097000 | Not Available | 713 | Open in IMG/M |
3300004643|Ga0062591_100088057 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
3300004778|Ga0062383_10117474 | Not Available | 1158 | Open in IMG/M |
3300005206|Ga0068995_10119031 | Not Available | 553 | Open in IMG/M |
3300005289|Ga0065704_10624102 | Not Available | 595 | Open in IMG/M |
3300005295|Ga0065707_10391848 | Not Available | 863 | Open in IMG/M |
3300005332|Ga0066388_104559865 | Not Available | 705 | Open in IMG/M |
3300005347|Ga0070668_100753705 | Not Available | 862 | Open in IMG/M |
3300005406|Ga0070703_10164578 | Not Available | 844 | Open in IMG/M |
3300005444|Ga0070694_101935910 | Not Available | 503 | Open in IMG/M |
3300005546|Ga0070696_100358150 | Not Available | 1131 | Open in IMG/M |
3300005554|Ga0066661_10533332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 705 | Open in IMG/M |
3300005556|Ga0066707_10009899 | All Organisms → cellular organisms → Bacteria | 4632 | Open in IMG/M |
3300005586|Ga0066691_10104217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1596 | Open in IMG/M |
3300005617|Ga0068859_100738810 | Not Available | 1073 | Open in IMG/M |
3300005713|Ga0066905_102066132 | Not Available | 530 | Open in IMG/M |
3300005764|Ga0066903_105704777 | Not Available | 654 | Open in IMG/M |
3300005843|Ga0068860_100445319 | Not Available | 1287 | Open in IMG/M |
3300005981|Ga0081538_10002997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16089 | Open in IMG/M |
3300006032|Ga0066696_10622618 | Not Available | 699 | Open in IMG/M |
3300006237|Ga0097621_102228875 | Not Available | 524 | Open in IMG/M |
3300007076|Ga0075435_101512872 | Not Available | 589 | Open in IMG/M |
3300007076|Ga0075435_101948333 | Not Available | 516 | Open in IMG/M |
3300009088|Ga0099830_11288910 | Not Available | 607 | Open in IMG/M |
3300009100|Ga0075418_10558187 | Not Available | 1231 | Open in IMG/M |
3300009100|Ga0075418_11708898 | Not Available | 684 | Open in IMG/M |
3300009100|Ga0075418_11928000 | Not Available | 643 | Open in IMG/M |
3300009147|Ga0114129_10339663 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300009157|Ga0105092_10188580 | Not Available | 1150 | Open in IMG/M |
3300009176|Ga0105242_11956434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300009176|Ga0105242_12348961 | Not Available | 580 | Open in IMG/M |
3300009176|Ga0105242_12794986 | Not Available | 538 | Open in IMG/M |
3300009792|Ga0126374_10005155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4563 | Open in IMG/M |
3300010037|Ga0126304_10499031 | Not Available | 817 | Open in IMG/M |
3300010043|Ga0126380_11414123 | Not Available | 612 | Open in IMG/M |
3300010360|Ga0126372_10039712 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
3300010360|Ga0126372_12769162 | Not Available | 542 | Open in IMG/M |
3300010366|Ga0126379_11242533 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300010371|Ga0134125_12738545 | Not Available | 536 | Open in IMG/M |
3300012140|Ga0137351_1050539 | Not Available | 590 | Open in IMG/M |
3300012179|Ga0137334_1148206 | Not Available | 531 | Open in IMG/M |
3300012210|Ga0137378_11580926 | Not Available | 565 | Open in IMG/M |
3300012211|Ga0137377_11255079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
3300012354|Ga0137366_10374855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1039 | Open in IMG/M |
3300012486|Ga0157331_1002814 | Not Available | 923 | Open in IMG/M |
3300012582|Ga0137358_10081241 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
3300012922|Ga0137394_11333575 | Not Available | 579 | Open in IMG/M |
3300012924|Ga0137413_11538246 | Not Available | 542 | Open in IMG/M |
3300012944|Ga0137410_11291654 | Not Available | 631 | Open in IMG/M |
3300012971|Ga0126369_13273410 | Not Available | 531 | Open in IMG/M |
3300014255|Ga0075320_1049270 | Not Available | 756 | Open in IMG/M |
3300014272|Ga0075327_1000076 | All Organisms → cellular organisms → Bacteria | 22480 | Open in IMG/M |
3300014311|Ga0075322_1180096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300014317|Ga0075343_1179952 | Not Available | 540 | Open in IMG/M |
3300015373|Ga0132257_100942583 | Not Available | 1084 | Open in IMG/M |
3300015374|Ga0132255_106200095 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300016319|Ga0182033_10810175 | Not Available | 825 | Open in IMG/M |
3300016422|Ga0182039_10144360 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300017654|Ga0134069_1313560 | Not Available | 558 | Open in IMG/M |
3300018054|Ga0184621_10266357 | Not Available | 608 | Open in IMG/M |
3300018063|Ga0184637_10328316 | Not Available | 923 | Open in IMG/M |
3300018084|Ga0184629_10076046 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300018422|Ga0190265_12816736 | Not Available | 581 | Open in IMG/M |
3300018466|Ga0190268_10110878 | Not Available | 1303 | Open in IMG/M |
3300018481|Ga0190271_11618447 | Not Available | 763 | Open in IMG/M |
3300019881|Ga0193707_1000526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 13306 | Open in IMG/M |
3300020004|Ga0193755_1011861 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
3300020018|Ga0193721_1139171 | Not Available | 595 | Open in IMG/M |
3300021178|Ga0210408_11476506 | Not Available | 510 | Open in IMG/M |
3300022563|Ga0212128_10084010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2054 | Open in IMG/M |
3300022756|Ga0222622_10314462 | Not Available | 1082 | Open in IMG/M |
3300025002|Ga0209001_1062969 | Not Available | 595 | Open in IMG/M |
3300025159|Ga0209619_10106952 | Not Available | 1664 | Open in IMG/M |
3300025164|Ga0209521_10416686 | Not Available | 727 | Open in IMG/M |
3300025319|Ga0209520_10657040 | Not Available | 596 | Open in IMG/M |
3300025327|Ga0209751_10530465 | Not Available | 957 | Open in IMG/M |
3300025567|Ga0210076_1103153 | Not Available | 624 | Open in IMG/M |
3300025921|Ga0207652_11298246 | Not Available | 630 | Open in IMG/M |
3300025938|Ga0207704_11163391 | Not Available | 657 | Open in IMG/M |
3300025962|Ga0210070_1034752 | Not Available | 605 | Open in IMG/M |
3300026111|Ga0208291_1015657 | Not Available | 1391 | Open in IMG/M |
3300026542|Ga0209805_1233871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300027006|Ga0209896_1010418 | Not Available | 1001 | Open in IMG/M |
3300027526|Ga0209968_1026130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 964 | Open in IMG/M |
3300027657|Ga0256865_1226978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300027722|Ga0209819_10271260 | Not Available | 587 | Open in IMG/M |
3300027875|Ga0209283_10521176 | Not Available | 762 | Open in IMG/M |
3300030006|Ga0299907_11088542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300030606|Ga0299906_10125043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2044 | Open in IMG/M |
3300031231|Ga0170824_101335896 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Pluteineae → Amanitaceae → Amanita → Amanita muscaria → Amanita muscaria Koide BX008 | 536 | Open in IMG/M |
3300031538|Ga0310888_10485197 | Not Available | 737 | Open in IMG/M |
3300031720|Ga0307469_12119415 | Not Available | 547 | Open in IMG/M |
3300031740|Ga0307468_100060345 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300032012|Ga0310902_10975455 | Not Available | 587 | Open in IMG/M |
3300032174|Ga0307470_10298639 | Not Available | 1091 | Open in IMG/M |
3300032211|Ga0310896_10628850 | Not Available | 602 | Open in IMG/M |
3300032770|Ga0335085_12199763 | Not Available | 554 | Open in IMG/M |
3300032828|Ga0335080_11286262 | Not Available | 731 | Open in IMG/M |
3300033417|Ga0214471_10185091 | Not Available | 1712 | Open in IMG/M |
3300033419|Ga0316601_102586774 | Not Available | 510 | Open in IMG/M |
3300034149|Ga0364929_0229268 | Not Available | 620 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.41% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.85% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300012140 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_02761080 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MPQNAVQKFIAATRALFAAEAEPVRRWEKMRPRASQ |
ICChiseqgaiiFebDRAFT_145800791 | 3300000363 | Soil | MSALKKFIDSARKLHAEEADPAKRWEKMTPLLQELIADPAVKEQ |
JGI11643J12802_118722252 | 3300000890 | Soil | MSQSAMQRFIDSTRELFAAETDPVKRWAKMPPLLRELL |
JGI10216J12902_1056334812 | 3300000956 | Soil | MSAVQKFIASARQLHAEEKDAAKRWEKMTPLLQELLADPSIK |
Ga0055467_101148992 | 3300003996 | Natural And Restored Wetlands | MSQSAVQKFIVSTRDLFAAEADPARRWERMPPLLQELLADPSIKEQAK |
Ga0055439_100361562 | 3300004019 | Natural And Restored Wetlands | MSAVQKFIASARKLHAEETDPAKRWEKMTPLLQELLADPSVKEQSK |
Ga0055488_100970001 | 3300004070 | Natural And Restored Wetlands | MSAVQRFIASARKLHAEETDPAKRWEKMTPLLQELIADPAVREQSKQWPD |
Ga0062591_1000880573 | 3300004643 | Soil | MSALKKFIDSARKLHAEEADPAKRWEKMTPLLQELIADPAVKEQS |
Ga0062383_101174741 | 3300004778 | Wetland Sediment | MMSKEVPMSAVKKFIDSARKIHAEETDPAKRWEKMTPLLQ |
Ga0068995_101190312 | 3300005206 | Natural And Restored Wetlands | MNAVQKFIVSARKLHAEEKDAVKRWEKMTPLLQELITDPAVREQ |
Ga0065704_106241022 | 3300005289 | Switchgrass Rhizosphere | MSQNAVQKFIGATRTLFATEADPAKRWEKMPPLLQELLADPWVKE |
Ga0065707_103918482 | 3300005295 | Switchgrass Rhizosphere | MSAVQKFIAAARKLHAEEKDPAIRWEKMTPLLQQLLADPS |
Ga0066388_1045598652 | 3300005332 | Tropical Forest Soil | MGALQKFIESARKLHAEEKNPAKRWEKMTPLLQELLADPSIGEQSKNWP |
Ga0070668_1007537051 | 3300005347 | Switchgrass Rhizosphere | MSQNAVQKFIGATRTLFATEADPAKRWEKMPPLLQELLAD |
Ga0070703_101645782 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQNAVQKFIVATRTLFATEADPAKRWEKMPPLLQELLADPWVK |
Ga0070694_1019359101 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKTAVTKFIAAARQLCAEEPDPATRWQKMTPLLQDLLAEPSVREQSKYWP |
Ga0070696_1003581501 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQNAVQKFIVATRTLCATEADPAKRWEKMPPLLQELLADPWVKEQS |
Ga0066661_105333322 | 3300005554 | Soil | MSVEPTSAVQKFIASARELHAEENDPAKRWEKMIPLLQQLLADPSV |
Ga0066707_100098998 | 3300005556 | Soil | MSVEPTSPVQKFIASARELHAGENGPAKRWEKMIPLLQQL |
Ga0066691_101042171 | 3300005586 | Soil | MSVEPTSPVQKFIASARELHAGENGPAKRWEKMIPLLQQLLADPSVKEQ |
Ga0068859_1007388101 | 3300005617 | Switchgrass Rhizosphere | MSQNAVQKFIVATRTLFATEADPAKRWEKMPPLLQELLADPWVKEQSRHW |
Ga0066905_1020661321 | 3300005713 | Tropical Forest Soil | MGALQKFIESARKLHAEEKSPAKRWEKMTPLLQELLADPSIREQSKSWPTCSQAER |
Ga0066903_1057047772 | 3300005764 | Tropical Forest Soil | MGALQKFIESARKLHAEERNPARRWEKMTPLLRELLADPSIREQSKSWPTCSQAERAQNLLF |
Ga0068860_1004453191 | 3300005843 | Switchgrass Rhizosphere | MSQNAVQKFIVATRTLFATEADPAKRWEKMPPLLQEL |
Ga0081538_1000299719 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSALQKFIDSARKLHAEENDPAKRWQKMTPLLQELLADPSIREQSKSWPTCSQADRAQ |
Ga0066696_106226181 | 3300006032 | Soil | MSQSAVQKFIDATRALFAVESDSAKRWQKMPPLLEELLANPALKEQSKTWPDCSQGS |
Ga0097621_1022288752 | 3300006237 | Miscanthus Rhizosphere | MSQNAVQKFIVATRTLFATEADPAKRWEKMPPLLQELLADPWVKEQSRHWP |
Ga0075435_1015128721 | 3300007076 | Populus Rhizosphere | MNAVQKFILSARKLHVEEKDAVKRWEKMTPLLQELIA |
Ga0075435_1019483332 | 3300007076 | Populus Rhizosphere | MSQTAVQKFVAATRTLFATETDPAKRWEKMPPLLQELLADPSV |
Ga0099830_112889102 | 3300009088 | Vadose Zone Soil | MPGSKSAVQSFIESARQLFAEEKDAAKRWEKMSPLLQVLL |
Ga0075418_105581872 | 3300009100 | Populus Rhizosphere | MNAVQKFILSARKLHAEEKDAAKRWEKMTPLLQELISDPAVKEQSKSWPACRQSD* |
Ga0075418_117088982 | 3300009100 | Populus Rhizosphere | MSAVQKFIDSARKLHAEEKDDAKRWEKMTPLLQELIADPAVKEQSKSWPACRQSDRAQ |
Ga0075418_119280002 | 3300009100 | Populus Rhizosphere | MSAVQKFIDSARKLHAEEKDAAKRWEKMTPLLQELIADPAVKEQSK |
Ga0114129_103396633 | 3300009147 | Populus Rhizosphere | MSAVQKFIDSARKLHAEEKDAAKRWEKMTPLLQELIADPAVKEQSKSW |
Ga0105092_101885801 | 3300009157 | Freshwater Sediment | MNALQKFIESARKLHAEEKDPAKRWEKMTPRLQELLADPSIREQSKSWPTCSQ |
Ga0105242_119564341 | 3300009176 | Miscanthus Rhizosphere | MSAVQRFIASARKVHAEESDPGKRWEKMTPLLQELIADPTVREQ |
Ga0105242_123489612 | 3300009176 | Miscanthus Rhizosphere | MSQSAVRKFIADARALFADESDPAKRWERLSPLLQELLADAS |
Ga0105242_127949861 | 3300009176 | Miscanthus Rhizosphere | MSKTAVTKFIAAARQLCAEEPDPATRWQKMTPLLQDLLAESSVREQSKYWPDCSQ |
Ga0126374_100051551 | 3300009792 | Tropical Forest Soil | MGALQKFIESARKLHAEEKSPAKRWEKMTPLLRELLAD |
Ga0126304_104990311 | 3300010037 | Serpentine Soil | MSAVQKFIASARELHAQETDPVKRWEKMTPLLQELISDPEVKEQSKHW |
Ga0126380_114141232 | 3300010043 | Tropical Forest Soil | MSGQSAVEKFIVSARRLHAEEQNPAKRWEKMTPLLQALLADPTVKEQSK |
Ga0126372_100397124 | 3300010360 | Tropical Forest Soil | MGALQKFIESVRKLHAEEKSPAKRWEKMTPLLRELLA |
Ga0126372_127691621 | 3300010360 | Tropical Forest Soil | MGALQKFIESARKLHAEEKSPAKRWEKMTPLLRELLADPSIREQSKSWPTCSQ |
Ga0126379_112425332 | 3300010366 | Tropical Forest Soil | MGALQKFIESARKLHAEERNPARRWEKMTPLLQEL |
Ga0134125_127385451 | 3300010371 | Terrestrial Soil | MPQSAVQKFIAATRALFAAEADPARRWEKLRPLLQELLADPAVKEQ |
Ga0137351_10505392 | 3300012140 | Soil | MSAVQTFIASARKLHAEEKDPAKRWEKMTPLLQELLADP |
Ga0137334_11482062 | 3300012179 | Soil | MGTETAVRKFIAAARKLHAEEEDAAKRWEKMTPLLQELLADA* |
Ga0137378_115809262 | 3300012210 | Vadose Zone Soil | MSQSAVQKFIDATRALFAVESDPAKRWQKMPSLLEELLANPAIK |
Ga0137377_112550792 | 3300012211 | Vadose Zone Soil | MSVEPTSAVQKFIASARELHAEENDPAKRWEKMIPLLQQLLADPSVKEQSTKWPDCS* |
Ga0137366_103748552 | 3300012354 | Vadose Zone Soil | MSVEPTSAVQKFIASARELHAEENDPAKRWEKMIPLLQQLLADPSVKEQSTKWPDCSQGGERAE |
Ga0157331_10028141 | 3300012486 | Soil | MSQSAVQKFIADARALFADESDPAKRWERMSPLLQELLADA |
Ga0137358_100812413 | 3300012582 | Vadose Zone Soil | MSHSAVQTFIDATRALFAVESDPAKRWQKMPPLLEEL |
Ga0137394_113335752 | 3300012922 | Vadose Zone Soil | MNAVQKFILSARKLHVEEKDAVKRWEKMTPLLQELIADPAVRE |
Ga0137413_115382461 | 3300012924 | Vadose Zone Soil | MSQSAVQKFIADARALFAVESDPAERWERMSPLLQ |
Ga0137410_112916541 | 3300012944 | Vadose Zone Soil | MSHSAVQTFIDATRALFAVESDPAKRWQKMPSLLEELL |
Ga0126369_132734101 | 3300012971 | Tropical Forest Soil | MGALQKFIESARKLHAEERNPARRWEKMTPLLRELLADPSIREQSGSWPTCSQAERA |
Ga0075320_10492701 | 3300014255 | Natural And Restored Wetlands | MSQSAVQRFIDSTRELFSAETDPVRRWEKMSPLLQELLADPSVKEQSKS |
Ga0075327_10000761 | 3300014272 | Natural And Restored Wetlands | MSQSAVQRFIDSTRELFSAETDPVRRWEKMSPLLQELLAD |
Ga0075322_11800962 | 3300014311 | Natural And Restored Wetlands | MSQFALKKFIASTRALFEQEADPASRWQKMTPILQELL |
Ga0075343_11799521 | 3300014317 | Natural And Restored Wetlands | MSQTAVQKFIEGARRLHADEKDDAKRWEKMAPLLQELLADPMVKEQSKRWPDCSQGSER |
Ga0132257_1009425831 | 3300015373 | Arabidopsis Rhizosphere | MSQSAVQKFIADARALFADESDPAKRWERMSPLLQELL |
Ga0132255_1062000952 | 3300015374 | Arabidopsis Rhizosphere | MPQSAVQKFIAATRVLFAAEADPARRWEKMRPLLQ |
Ga0182033_108101751 | 3300016319 | Soil | MSAVQKFIVSAGKLHAEEKDPAKRWKKMTALLQELLVDP |
Ga0182039_101443603 | 3300016422 | Soil | MSAVQRFIVSARKLHAEEKDSAKRWKKMTALLQELLVDPSL |
Ga0134069_13135601 | 3300017654 | Grasslands Soil | MSVEPTSAVQKFIASARELHAEENDPAKRWEKMIPLLQQLLADPSVKEQSTKWPDCS |
Ga0184621_102663571 | 3300018054 | Groundwater Sediment | MSAVQKFIASARQLHAEEKDAAKHWEKMTPLLQELLADPS |
Ga0184637_103283162 | 3300018063 | Groundwater Sediment | MSAVQKFIASARKLHAEENDPAKRWEKMIPLLQELLADPSVKEQSRNWPGCSQGGERAEN |
Ga0184629_100760463 | 3300018084 | Groundwater Sediment | MGSHSAVQKFIASARRLHAEERDSKKRWEKMTPLLQ |
Ga0190265_128167361 | 3300018422 | Soil | MSQPAVQKFIDSTRDLFAAETDPAKRWAKMPPLLQELLADPSLKEQSR |
Ga0190268_101108782 | 3300018466 | Soil | MSAVQKFIASARQLHAEETDPAKRWEKMTPLLEELIADP |
Ga0190271_116184472 | 3300018481 | Soil | MSAVQKFIASARQLHAEETDPATRWEKMTPLLEELIADPAVREQSKHW |
Ga0193707_100052617 | 3300019881 | Soil | MSHSAVQKFIDATRALFAVESDPAKRWQKMPSLLEELLANPAIKEQ |
Ga0193755_10118611 | 3300020004 | Soil | MSQSAVQKFIADARALFAVESDPAKRWEGMSPLLREL |
Ga0193721_11391711 | 3300020018 | Soil | MSHSAVQKFIDATRALFAVESDPAKRWQKMPSLLEELLAN |
Ga0210408_114765061 | 3300021178 | Soil | MSGSKTAVQNFIESARQLFAEENDPVKRWEKMSPLLQVLLADKSVKEQSRN |
Ga0212128_100840101 | 3300022563 | Thermal Springs | MAGPTAIQKFITRARQLHAAETNLSKRWEKMTPLLEDLLSDPSVKEQSKSW |
Ga0222622_103144621 | 3300022756 | Groundwater Sediment | MSALQKFIASARKLHAEEKDSAKRWQKMKPLLQELLADPSVKEQSRCWPDC |
Ga0209001_10629692 | 3300025002 | Soil | MAGQSAVQKFIASARQLHAEEKDPAKRWENLTPLLQELLADPLVKEQSTKWPDCSQ |
Ga0209619_101069521 | 3300025159 | Soil | MAGQSAVQKFIASARQLHAEEKDPAKRWENLTPLLQELLADPLVKEQSTKW |
Ga0209521_104166861 | 3300025164 | Soil | MGQQPAVQKFIASARALFAQEREPAARWRQMTPLLQELLADP |
Ga0209520_106570402 | 3300025319 | Soil | MGIQTAVQRFIASARQLHTEEKDPAKRWARMTPLLQELLADPAVKEQSTKWPDCSQGGEH |
Ga0209751_105304651 | 3300025327 | Soil | MAGQSAVQKFIASARQLHAEEKDPAKRWENLTPLLQELLADPLVKEQS |
Ga0210076_11031531 | 3300025567 | Natural And Restored Wetlands | MSQTAVQKFIEGARRLHADEKDDAKRWEKMAPLLQELLAD |
Ga0207652_112982462 | 3300025921 | Corn Rhizosphere | MSQSAVQKFIASTRALFAAEADPAKRWERMPPLLQELLADPSVKEQSKS |
Ga0207704_111633911 | 3300025938 | Miscanthus Rhizosphere | MSQSSVQKFIADARALFAVESDPAKRWERMSPLLQ |
Ga0210070_10347521 | 3300025962 | Natural And Restored Wetlands | MNAVQKFIVSARKLHAEEKDAVKRWEKMTPLLQELITDPAVREQSMSW |
Ga0208291_10156574 | 3300026111 | Natural And Restored Wetlands | MSQSAVQRFIDSTRELFSAETDPVRRWEKMSPLLQELLADP |
Ga0209805_12338711 | 3300026542 | Soil | MSVEPTSAVQKFIASARELHAEENDPAKRWEKMIPLLQQLLADPSVKEQSTKWPDCSQGGERAEN |
Ga0209896_10104182 | 3300027006 | Groundwater Sand | MNAVQKFIVSARKLHAEEKDAAKRWEKMIPVLQELIADPAVKEQSKSWPA |
Ga0209968_10261301 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MSQSAVQKFIASTRDLFAAEADPARRWERMPPLLQELLADP |
Ga0256865_12269781 | 3300027657 | Soil | MSQSAVQKFIAAARDLFAAEADPAKRWEKMSPLLQELLADPSIQEQSKKWPDC |
Ga0209819_102712601 | 3300027722 | Freshwater Sediment | MSALQKFIESARKLHAEEKDPAKRWEKMTPRLQELLADP |
Ga0209283_105211762 | 3300027875 | Vadose Zone Soil | MPGSKTAFQSFIESARRLFAEEKDAAKRWEKMSPLLQVLLADESIKEQSKSWPGCSQGSDRA |
Ga0299907_110885422 | 3300030006 | Soil | MSQSAMQKFIDSTRDLFAAESDPAKRWAKMPPLLQELLADP |
Ga0299906_101250434 | 3300030606 | Soil | MSQSAVQKFIAAARDLFAAEADPAKRWEKMSPLLQELLADPS |
Ga0170824_1013358961 | 3300031231 | Forest Soil | VSARKLHAEEKDPAKRWEKMPPLLQELLADPSVKEQSNGWPTLW |
Ga0310888_104851971 | 3300031538 | Soil | MSQSAVQKFIADARALFAVESDPAKRWQRMSPLLQELLADASIRAQSKNWPNCSQGSERA |
Ga0307469_121194152 | 3300031720 | Hardwood Forest Soil | MSAVQKFIDSARKLHAEEKDAAKRWEKMTPLLQELIADPAVKEQSKRWPACRQSDRAQ |
Ga0307468_1000603453 | 3300031740 | Hardwood Forest Soil | MSGSKTAVQNFIESARGLFAEEKDPAKRWEKMSPLLQVLLADESLKEQSRNWP |
Ga0326597_106446592 | 3300031965 | Soil | MSSQTAVQRFIASARQLHAEEKEPAKRWQRMTPLLEELLADPLV |
Ga0310902_109754552 | 3300032012 | Soil | MNAVQKFIVSARKLHAEEKDASKRWEKMIPLLQELI |
Ga0307470_102986391 | 3300032174 | Hardwood Forest Soil | MNAVQKFILSARKLHVEEKDAVKRWEKMTPLLQELIADPTVREQSRSWP |
Ga0310896_106288502 | 3300032211 | Soil | MPQSAVQKFIAATRALFAAEADPVRRWEKMRPLLQELLADPAVKEESR |
Ga0335085_121997631 | 3300032770 | Soil | MPESKTAVQTFIESTRRLFAEEKDPAKRWAKMSPLLEVLLADESVKQQSKNWPGCAQGSDRAE |
Ga0335080_112862621 | 3300032828 | Soil | MPESKTAVQTFIESTRRLFAREQDPAKRWAKMSPLL |
Ga0214471_101850911 | 3300033417 | Soil | MSSQSAVQKFIASARSLHAEEKDAAKRWEKMTPHLQELLADPSV |
Ga0316601_1025867741 | 3300033419 | Soil | MSAVKKFIASARMLHAEEADPAKRWEKMTPLLQELIADPAV |
Ga0364929_0229268_1_105 | 3300034149 | Sediment | MSAVQKFIASARQLHAEEKDAAKRWEKMTPLLQEL |
⦗Top⦘ |