Metagenome / Metatranscriptome Family F090457

Basic Information
Family ID	F090457
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	43 residues
Representative Sequence	QFAKVSGVASPGTPQDYAAFLAAEQAKWSRVVSAIGFKEN
Number of Associated Samples	102
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.93 %
% of genes near scaffold ends (potentially truncated)	98.15 %
% of genes from short scaffolds (< 2000 bps)	91.67 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (75.926 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.111 % of family members)
Environment Ontology (ENVO)	Unclassified (39.815 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (38.889 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF02698	DUF218	11.11
PF03401	TctC	10.19
PF13279	4HBT_2	9.26
PF01594	AI-2E_transport	8.33
PF05762	VWA_CoxE	5.56
PF01546	Peptidase_M20	4.63
PF02627	CMD	3.70
PF00903	Glyoxalase	3.70
PF03328	HpcH_HpaI	3.70
PF00990	GGDEF	2.78
PF05035	DGOK	1.85
PF02826	2-Hacid_dh_C	1.85
PF00246	Peptidase_M14	1.85
PF12848	ABC_tran_Xtn	0.93
PF07687	M20_dimer	0.93
PF12681	Glyoxalase_2	0.93
PF11294	DUF3095	0.93
PF01425	Amidase	0.93
PF08238	Sel1	0.93
PF04392	ABC_sub_bind	0.93
PF16326	ABC_tran_CTD	0.93
PF02545	Maf	0.93
PF11141	DUF2914	0.93
PF03737	RraA-like	0.93
PF04290	DctQ	0.93
PF11533	DUF3225	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG1434	Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family	Cell wall/membrane/envelope biogenesis [M]	11.11
COG2949	Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin	Cell wall/membrane/envelope biogenesis [M]	11.11
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	10.19
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	8.33
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	3.70
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	3.70
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	3.70
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	3.70
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	3.70
COG3734	2-keto-3-deoxy-galactonokinase	Carbohydrate transport and metabolism [G]	1.85
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.93
COG0424	7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.93
COG0684	RNA degradosome component RraA (regulator of RNase E activity)	Translation, ribosomal structure and biogenesis [J]	0.93
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.85 %
Unclassified	root	N/A	23.15 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.85 %
Unclassified	root	N/A	23.15 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.93 %
Unclassified	root	N/A	23.15 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.93 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	57.41 %
Unclassified	root	N/A	23.15 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	12.96 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9.26 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.85 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.93 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.93 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.93 %
Acidimicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales	0.93 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
unclassified Acidimicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	8.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.78 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.93 %
Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000955\|JGI1027J12803_100130740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	675	Open in IMG/M
3300004463\|Ga0063356_106438225	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300004480\|Ga0062592_100563118	All Organisms → cellular organisms → Bacteria → Proteobacteria	959	Open in IMG/M
3300005177\|Ga0066690_10854525	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300005184\|Ga0066671_10652933	All Organisms → cellular organisms → Bacteria → Proteobacteria	683	Open in IMG/M
3300005206\|Ga0068995_10032385	All Organisms → cellular organisms → Bacteria → Proteobacteria	875	Open in IMG/M
3300005353\|Ga0070669_101498105	All Organisms → cellular organisms → Bacteria → Proteobacteria	586	Open in IMG/M
3300005444\|Ga0070694_100221293	All Organisms → cellular organisms → Bacteria → Proteobacteria	1420	Open in IMG/M
3300005450\|Ga0066682_10398802	All Organisms → cellular organisms → Bacteria → Proteobacteria	881	Open in IMG/M
3300005451\|Ga0066681_10075546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1890	Open in IMG/M
3300005457\|Ga0070662_100404447	All Organisms → cellular organisms → Bacteria → Proteobacteria	1127	Open in IMG/M
3300005543\|Ga0070672_100757666	All Organisms → cellular organisms → Bacteria → Proteobacteria	852	Open in IMG/M
3300005561\|Ga0066699_10315597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1114	Open in IMG/M
3300005574\|Ga0066694_10326368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	729	Open in IMG/M
3300005576\|Ga0066708_10441003	All Organisms → cellular organisms → Bacteria → Proteobacteria	836	Open in IMG/M
3300005615\|Ga0070702_100222423	All Organisms → cellular organisms → Bacteria → Proteobacteria	1263	Open in IMG/M
3300006032\|Ga0066696_10772573	All Organisms → cellular organisms → Bacteria → Proteobacteria	614	Open in IMG/M
3300006046\|Ga0066652_100634457	All Organisms → cellular organisms → Bacteria → Proteobacteria	1011	Open in IMG/M
3300006058\|Ga0075432_10448400	All Organisms → cellular organisms → Bacteria → Proteobacteria	566	Open in IMG/M
3300006358\|Ga0068871_100318942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1368	Open in IMG/M
3300006845\|Ga0075421_101696280	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300006846\|Ga0075430_100289027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1356	Open in IMG/M
3300006871\|Ga0075434_101162003	All Organisms → cellular organisms → Bacteria → Proteobacteria	784	Open in IMG/M
3300006876\|Ga0079217_11227731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	573	Open in IMG/M
3300006894\|Ga0079215_11279538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	565	Open in IMG/M
3300006954\|Ga0079219_11282760	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300007004\|Ga0079218_10771547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	917	Open in IMG/M
3300007076\|Ga0075435_100856245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	792	Open in IMG/M
3300009012\|Ga0066710_104411108	Not Available	526	Open in IMG/M
3300009089\|Ga0099828_11546790	All Organisms → cellular organisms → Bacteria → Proteobacteria	584	Open in IMG/M
3300009137\|Ga0066709_103305568	Not Available	587	Open in IMG/M
3300009147\|Ga0114129_12950422	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300009162\|Ga0075423_10981855	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300009553\|Ga0105249_10382797	All Organisms → cellular organisms → Bacteria	1433	Open in IMG/M
3300009803\|Ga0105065_1018171	Not Available	808	Open in IMG/M
3300010301\|Ga0134070_10343992	Not Available	577	Open in IMG/M
3300010320\|Ga0134109_10063002	Not Available	1245	Open in IMG/M
3300010326\|Ga0134065_10406968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	547	Open in IMG/M
3300010335\|Ga0134063_10286941	Not Available	789	Open in IMG/M
3300010403\|Ga0134123_11211786	Not Available	786	Open in IMG/M
3300011403\|Ga0137313_1050080	All Organisms → cellular organisms → Bacteria → Proteobacteria	723	Open in IMG/M
3300011413\|Ga0137333_1050954	All Organisms → cellular organisms → Bacteria → Proteobacteria	939	Open in IMG/M
3300011421\|Ga0137462_1106451	Not Available	670	Open in IMG/M
3300011430\|Ga0137423_1017954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2198	Open in IMG/M
3300011443\|Ga0137457_1076407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1028	Open in IMG/M
3300012022\|Ga0120191_10106655	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300012159\|Ga0137344_1005267	Not Available	1796	Open in IMG/M
3300012203\|Ga0137399_10138740	All Organisms → cellular organisms → Bacteria → Proteobacteria	1930	Open in IMG/M
3300012207\|Ga0137381_11530155	Not Available	559	Open in IMG/M
3300012469\|Ga0150984_100415543	All Organisms → cellular organisms → Bacteria → Proteobacteria	550	Open in IMG/M
3300012512\|Ga0157327_1070955	All Organisms → cellular organisms → Bacteria → Proteobacteria	540	Open in IMG/M
3300012683\|Ga0137398_10952640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	596	Open in IMG/M
3300014326\|Ga0157380_10033906	All Organisms → cellular organisms → Bacteria → Proteobacteria	3934	Open in IMG/M
3300014877\|Ga0180074_1082353	Not Available	711	Open in IMG/M
3300014878\|Ga0180065_1039423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	998	Open in IMG/M
3300015054\|Ga0137420_1007415	Not Available	597	Open in IMG/M
3300015054\|Ga0137420_1231927	Not Available	736	Open in IMG/M
3300015054\|Ga0137420_1281294	Not Available	1070	Open in IMG/M
3300015255\|Ga0180077_1071913	All Organisms → cellular organisms → Bacteria → Proteobacteria	710	Open in IMG/M
3300018027\|Ga0184605_10045946	All Organisms → cellular organisms → Bacteria → Proteobacteria	1846	Open in IMG/M
3300018060\|Ga0187765_10219713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1106	Open in IMG/M
3300018083\|Ga0184628_10046220	All Organisms → cellular organisms → Bacteria → Proteobacteria	2192	Open in IMG/M
3300018429\|Ga0190272_12146651	All Organisms → cellular organisms → Bacteria → Proteobacteria	597	Open in IMG/M
3300019257\|Ga0180115_1109900	Not Available	529	Open in IMG/M
3300020146\|Ga0196977_1088400	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300020150\|Ga0187768_1126936	All Organisms → cellular organisms → Bacteria → Proteobacteria	586	Open in IMG/M
3300020202\|Ga0196964_10512044	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300020202\|Ga0196964_10613385	Not Available	536	Open in IMG/M
3300020202\|Ga0196964_10683766	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300020215\|Ga0196963_10211300	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300021363\|Ga0193699_10023383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2272	Open in IMG/M
3300024347\|Ga0179591_1254219	Not Available	4384	Open in IMG/M
3300025900\|Ga0207710_10482300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium	642	Open in IMG/M
3300025906\|Ga0207699_10471515	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300025910\|Ga0207684_11281718	Not Available	604	Open in IMG/M
3300025912\|Ga0207707_10899118	Not Available	732	Open in IMG/M
3300025917\|Ga0207660_11394756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	568	Open in IMG/M
3300025918\|Ga0207662_11288703	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300025931\|Ga0207644_10468019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1037	Open in IMG/M
3300025935\|Ga0207709_10102269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1897	Open in IMG/M
3300025936\|Ga0207670_10205279	All Organisms → cellular organisms → Bacteria → Proteobacteria	1499	Open in IMG/M
3300025940\|Ga0207691_10156058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2004	Open in IMG/M
3300026297\|Ga0209237_1025754	All Organisms → cellular organisms → Bacteria → Proteobacteria	3284	Open in IMG/M
3300026325\|Ga0209152_10202175	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	746	Open in IMG/M
3300026532\|Ga0209160_1264679	Not Available	584	Open in IMG/M
3300027360\|Ga0209969_1037209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	751	Open in IMG/M
3300027614\|Ga0209970_1115558	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300027671\|Ga0209588_1050486	All Organisms → cellular organisms → Bacteria → Proteobacteria	1346	Open in IMG/M
3300027681\|Ga0208991_1058625	Not Available	1162	Open in IMG/M
3300027787\|Ga0209074_10265569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	673	Open in IMG/M
3300027876\|Ga0209974_10245134	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300027886\|Ga0209486_10520819	Not Available	742	Open in IMG/M
3300027886\|Ga0209486_10872341	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300028590\|Ga0247823_10794621	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300031226\|Ga0307497_10005816	All Organisms → cellular organisms → Bacteria	3309	Open in IMG/M
3300031548\|Ga0307408_101298738	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300031562\|Ga0310886_10359307	Not Available	849	Open in IMG/M
3300031731\|Ga0307405_10576483	All Organisms → cellular organisms → Bacteria → Proteobacteria	915	Open in IMG/M
3300031740\|Ga0307468_100676555	All Organisms → cellular organisms → Bacteria → Proteobacteria	858	Open in IMG/M
3300031858\|Ga0310892_10456135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	843	Open in IMG/M
3300031901\|Ga0307406_11952437	All Organisms → cellular organisms → Bacteria → Proteobacteria	524	Open in IMG/M
3300032002\|Ga0307416_103680162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	513	Open in IMG/M
3300032005\|Ga0307411_11478036	All Organisms → cellular organisms → Bacteria → Proteobacteria	624	Open in IMG/M
3300032144\|Ga0315910_11313565	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300032144\|Ga0315910_11475853	All Organisms → cellular organisms → Bacteria → Proteobacteria	530	Open in IMG/M
3300032180\|Ga0307471_100939357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1032	Open in IMG/M
3300033475\|Ga0310811_10538641	Not Available	1203	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	74.07%
Host-Associated	Host-Associated	25.93%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	62.04%
Plants	Host-Associated → Plants	25.93%
Aquatic	Environmental → Aquatic	12.04%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.37%
Sediment	Environmental → Aquatic → Sediment	10.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.63%
Freshwater	Environmental → Aquatic → Freshwater	0.93%
Marine	Environmental → Aquatic → Marine	0.93%
Roots	Host-Associated → Plants → Roots	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.19%
Loam	Environmental → Terrestrial → Soil → Loam	8.33%
Sand	Environmental → Terrestrial → Soil → Sand	5.56%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.56%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.63%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.85%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.93%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.93%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.81%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.19%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.41%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.41%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.56%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	4.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.63%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.93%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.11%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.26%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	8.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.48%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.56%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	4.63%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.63%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.70%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.70%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.70%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.78%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.85%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.85%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.85%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.93%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.93%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.93%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.93%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005206	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011403	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2	Environmental	Open in IMG/M
3300011413	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2	Environmental	Open in IMG/M
3300011421	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012159	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Host-Associated	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300014878	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D	Environmental	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015255	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300019257	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental	Open in IMG/M
3300020150	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG	Environmental	Open in IMG/M
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F090457

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J12803_1001307401	3300000955	Soil	AVAEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQTQ*
Ga0063356_1064382252	3300004463	Arabidopsis Thaliana Rhizosphere	DEQFAKVGGIAAPTTPQEYQRFIASEQAKWSKIVQAIGFKE*
Ga0062592_1005631183	3300004480	Soil	AAALAALKSKAVQEQFSKVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE*
Ga0066690_108545252	3300005177	Soil	SRAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSKIVAAIGFKE*
Ga0066671_106529332	3300005184	Soil	AALKSNAVIEQMAKVGGVASPTTPQEYAKFVEAEQEKWGRIVTAIGFKEQN*
Ga0068995_100323851	3300005206	Natural And Restored Wetlands	KSAAVAEQFAKVGGTASPNTPQEYAAFLAAEQEKWGRVVQAIGFKE*
Ga0070669_1014981051	3300005353	Switchgrass Rhizosphere	AVTEQFAKVGGLASPGTPQDYAAFLAKAQEKWSRVVNAIGFKEQNQ*
Ga0070694_1002212931	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	KAVDEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE*
Ga0066682_103988022	3300005450	Soil	RSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN*
Ga0066681_100755463	3300005451	Soil	ALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN*
Ga0070662_1004044472	3300005457	Corn Rhizosphere	VDEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE*
Ga0070672_1007576661	3300005543	Miscanthus Rhizosphere	VTEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ*
Ga0066699_103155971	3300005561	Soil	EQFARVSGVASPGTPQDYAAFLAAEQARWSKIVAAIGFKE*
Ga0066694_103263681	3300005574	Soil	GVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEH*
Ga0066708_104410031	3300005576	Soil	LKSHKLPGTPQDYAKFLAAEQAKWGPIVTAIGFKEQN*
Ga0070702_1002224231	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	EQFAKVGGLASPGTPQDYAEFLAKEQAKWSRVVSAIGFKEQNQ*
Ga0066696_107725732	3300006032	Soil	KVGGVASPTTPQEYAKFIETEQAKWGRIVTAIGFKEQN*
Ga0066652_1006344571	3300006046	Soil	KVGGVASPTTPQEYAKFVEAEQEKWGRIVTAIGFKEQN*
Ga0075432_104484001	3300006058	Populus Rhizosphere	HAAATNALRSAAVMEQYSKVGGIASPSSPRDYAMFIAAEQAKWSRIVTAIGFKE*
Ga0068871_1003189421	3300006358	Miscanthus Rhizosphere	LKSPAVTEQFAKVGGLASPGTPQDYAEFLAKEQAKWSRVVSAIGFKEQNQ*
Ga0075421_1016962801	3300006845	Populus Rhizosphere	GGIASPTTPQDYVAFIAAEQAKWSKIVQAIGFKE*
Ga0075430_1002890273	3300006846	Populus Rhizosphere	GGIAAPGTPQEYAAFLAAEQAKWSKLVAAIGFKEQTQ*
Ga0075434_1011620032	3300006871	Populus Rhizosphere	FASVSAIVSPGTPQEYAAFLAGEQAKWSKVVNAIGFKEAVQ*
Ga0079217_112277311	3300006876	Agricultural Soil	SGIASPGTPQDYAAFLAAEQAKWSKVVQAIGFKE*
Ga0079215_112795381	3300006894	Agricultural Soil	TEQYAKVGGLASPGTPQEYAAFLEREQAKWSKVVNAIGFKEQN*
Ga0079219_112827602	3300006954	Agricultural Soil	QFAKVGGVASPSSPQEYAKFLEAEQAKWGKVVNAIGFKEQN*
Ga0079218_107715471	3300007004	Agricultural Soil	KVSGVASPGTPQDYAAFLAAEQAKWSKIVQAIGFKE*
Ga0075435_1008562451	3300007076	Populus Rhizosphere	SKLKDQYANVGGVASPGTPQEYAAFLSAEQAKWSKIVAAIGFKEQQQ*
Ga0066710_1044111082	3300009012	Grasslands Soil	SGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN
Ga0099828_115467901	3300009089	Vadose Zone Soil	VASPGTPQDYAKFLETEQAKWGKVVSAIGFKEQN*
Ga0066709_1033055681	3300009137	Grasslands Soil	ALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN*
Ga0114129_129504222	3300009147	Populus Rhizosphere	VAEQFAKVGGLASPGTPQEYAAFLATEQVKWNKVVTAIGFKEQN*
Ga0075423_109818552	3300009162	Populus Rhizosphere	LKSPAVTEQFAKVGGLASPGTPQEYASFLAKEQEKWSRVVSAIGFKEQN*
Ga0105249_103827974	3300009553	Switchgrass Rhizosphere	ASAALRSKPLNDQFAAVSAIPSPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ*
Ga0105065_10181712	3300009803	Groundwater Sand	VGGIAAPTSSQDYAAFIASEQAKWSRIVTAIGFKE*
Ga0134070_103439921	3300010301	Grasslands Soil	QFGKVSGVAAPGTPQEYASFLAGEQAKWSKIVSAIGFKEEN*
Ga0134109_100630021	3300010320	Grasslands Soil	ATTALRSPAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSTIGFKEN*
Ga0134065_104069682	3300010326	Grasslands Soil	VAAPGTPQDYAKFLETEQAKWGKVVTAIGFKEQN*
Ga0134063_102869412	3300010335	Grasslands Soil	ALRSPAVIEQFAKVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN*
Ga0134123_112117862	3300010403	Terrestrial Soil	SNSLAATYANVGGIASPGTPEEYAAFLEDEQDKWRKVVNAIGFKEGS*
Ga0137313_10500801	3300011403	Soil	VGGLASPGTPQDYAAFLAREQEKWSRVVSAIGFKEQNQ*
Ga0137333_10509541	3300011413	Soil	AKAGEEEFGKVGGGGSPGKPPGYQSFIAAEQAKWSKIVQAIGFKE*
Ga0137462_11064512	3300011421	Soil	ALQSSSLREQYAKIGGIASPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ*
Ga0137423_10179541	3300011430	Soil	EQFSKVGGIAAPTTPQDYVAFIAAEQAKWSKVVQAIGFKE*
Ga0137457_10764073	3300011443	Soil	KVGGIASPTSPQDYQSFIAAEQAKWSKIVQAIGFKE*
Ga0120191_101066552	3300012022	Terrestrial	MKMCVENAVDEQFAKVGGIASPGTPQEYQSFIAAEQAKWSKIVQAIGFKE*
Ga0137344_10052671	3300012159	Soil	QFAKVGGIASPGTPQEYQSFIAAEQAKWSRIVTAIGFKE*
Ga0137399_101387404	3300012203	Vadose Zone Soil	VAAPSTPQDYAKFVEGEQAKWGRIVNAIGFKEQN*
Ga0137381_115301552	3300012207	Vadose Zone Soil	PAVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEH*
Ga0150984_1004155432	3300012469	Avena Fatua Rhizosphere	ASPGTPQDYAAFLAKEQEKWSRVVSAIGFKEQNQ*
Ga0157327_10709551	3300012512	Arabidopsis Rhizosphere	QFAKVGGVASPGTPQDYAAFLAKEQEKWSRVVSAIGFKEQVQ*
Ga0137398_109526402	3300012683	Vadose Zone Soil	IAQFEKVGGVASPGTPQDYAAFVAAEQAKWSRIVDAIGFKE*
Ga0137397_112479541	3300012685	Vadose Zone Soil	KVAGVASPSSPQECAQFVEREQAKWGKIVKAIGIRVD*
Ga0157380_100339061	3300014326	Switchgrass Rhizosphere	EQFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE*
Ga0180074_10823531	3300014877	Soil	LMERYAKVGGIASPGSPQDYAAFIAAEQAKWSKVVTAIGFKE*
Ga0180065_10394231	3300014878	Soil	EQYAKIGGIAAPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ*
Ga0137420_10074151	3300015054	Vadose Zone Soil	DDGAALASRAVIEQFARVSGVASPGTPHDYAAFLAAEQAKWSQVVSAIGFKEN*
Ga0137420_12319271	3300015054	Vadose Zone Soil	RSRIAWHTPHDYAAFLAAEQAKWSKVVSAIGFKEN*
Ga0137420_12812942	3300015054	Vadose Zone Soil	ARVSGVASPGTPHDYAAFLAAEQAKWSKVVSAIGFKEN*
Ga0180077_10719132	3300015255	Soil	ALKSKAVEEQFAKVGGVASPGTPQEYQSFIAAEQAKWSRIVTAIGFKE*
Ga0184605_100459461	3300018027	Groundwater Sediment	KSGAVAEQFAKVGGLASPGTPQDYAAFLAHEQAKWSRIVTAIGFKEQN
Ga0187765_102197131	3300018060	Tropical Peatland	EQFAKVGGVASPSTQEEYAKFLAGEQAKWSKIVQAIGFKEE
Ga0184628_100462204	3300018083	Groundwater Sediment	VAALQSSNLKEQYLRVGGVASPGTPQEYAAFLAAEQEKWSKVVVAIGFKEQTQ
Ga0190272_121466511	3300018429	Soil	KVGGLASPGTPQEYAAFLAAEQAKWSKVVTAIGFKEQN
Ga0180115_11099002	3300019257	Groundwater Sediment	LASPGTPQEYAAFLAAEQAKWSKVVAAIGFKEQTQ
Ga0196977_10884001	3300020146	Soil	AVEEQFAKVGGIASPGTPQDYARFIAAEQAKWSRIVQAIGFKE
Ga0187768_11269362	3300020150	Tropical Peatland	RDPTLVERFARISAVPSPGTPEDYAAFLAAEQAKWSKIVAAIGFRE
Ga0196964_105120442	3300020202	Soil	SKPVEEQFSKVGGIASPGTPQEYAAFIAAEQAKWSRIVQAIGFKE
Ga0196964_106133852	3300020202	Soil	LAALKSKPIEEQFSKVGGIASPGTPQQYAAFIAAEQAKWSKIVQAIGFKE
Ga0196964_106837662	3300020202	Soil	KPVEEQLSKVGGIASPTTPQEYAAFIAAEQAKWSKIVQAIGFKE
Ga0196963_102113001	3300020215	Soil	AVAALRSKPVEEQFSKVGGIASPGTPQEYAAFIASEQAKWSKIVQAIGFKE
Ga0193699_100233833	3300021363	Soil	KLHAAAVTALQSASLKDQYSKVGGIASPGSPQDFAAFLAAEQTKWSQVVSAIGFKEQTQ
Ga0179591_12542191	3300024347	Vadose Zone Soil	QFARVGGVAMPGSPQDFAAFLAAEQTKWSKVVTAIGFKEQTQ
Ga0207710_104823001	3300025900	Switchgrass Rhizosphere	PAIKEQYAKVGGIASPGTPQDYAAFLAAEQAKWSKVVEAIGFKEQTQ
Ga0207699_104715153	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	VSGVAAPSTPQEYATFLGAEQAKWSKIVQAIGFKEEN
Ga0207684_112817182	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	HAAAMTALRSHAVVEQFARVSGVASPGTPQDYAAFLAAEQAKWSKVVSAIGFKEN
Ga0207707_108991182	3300025912	Corn Rhizosphere	QYAKVAGVASPGSPEDYAKFLAAEQAKWSQVVTAIGFKQQN
Ga0207660_113947561	3300025917	Corn Rhizosphere	AVDEQFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE
Ga0207662_112887031	3300025918	Switchgrass Rhizosphere	AVTEQFAKVGGLASPGTPQDYAAFLAKEQEKWSRVVNAIGFKEQNQ
Ga0207644_104680192	3300025931	Switchgrass Rhizosphere	SKAVEDQFAKVGGIPSPTTPQEYAHFVETEQAKWGKVVTAIGFKENN
Ga0207709_101022691	3300025935	Miscanthus Rhizosphere	DEQFAKVGGIAAPTTSQEYQSFIAAEQAKWSKIVTAIGFKE
Ga0207670_102052793	3300025936	Switchgrass Rhizosphere	QFAKVGGIAAPTTPQEYAAFIAAEQAKWSKIVNAIGFKE
Ga0207691_101560581	3300025940	Miscanthus Rhizosphere	VAALKSKTVDEQFAKVGGIAAPSTPQEYQSFIAAEQAKWSKIVTAIGFKE
Ga0209237_10257541	3300026297	Grasslands Soil	AVIEQFARVSGVASPGTPQDYAAFLAAEQAKWSQVVSAIGFKEN
Ga0209152_102021751	3300026325	Soil	FARVSGVASPGTPQDYAAFLAAEQARWSKIVAAIGFKE
Ga0209160_12646792	3300026532	Soil	QFAKVSGVASPGTPQDYAAFLAAEQAKWSRVVSAIGFKEN
Ga0209969_10372092	3300027360	Arabidopsis Thaliana Rhizosphere	ALRSKAVDETFAKVGGIASPGTPQEYQAFIAAEQAKWSKIVQAIGFKE
Ga0209970_11155582	3300027614	Arabidopsis Thaliana Rhizosphere	KVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE
Ga0209588_10504863	3300027671	Vadose Zone Soil	RSPALTEQYSNVSGEASPGTPQDYASFLAAEQAKWSRIVDAIGFRE
Ga0208991_10586252	3300027681	Forest Soil	EQFAKVSGVASPGTPQDYASFLAAEQAKWSQVVSAIGFKEN
Ga0209074_102655691	3300027787	Agricultural Soil	FAKVGGVASPTTPQEYAKFIETEQAKWGRIVTAIGFKEQN
Ga0209974_102451343	3300027876	Arabidopsis Thaliana Rhizosphere	LKSKAVQEQFSKVGGIASPGTPQEYQAFIAAEQAKWSRIVQAIGFKE
Ga0209486_105208191	3300027886	Agricultural Soil	GGIAAGGSPQDYAAFLASEQAKWSKVVTAIGFKEQTQ
Ga0209486_108723412	3300027886	Agricultural Soil	KVGGIAAPGTPQEYAAFIAAEQAKWSKIVQAIGFKE
Ga0247823_107946213	3300028590	Soil	VSGVPSPGTPEDYARFLAAEQAKWSKVVSAIGFKN
Ga0307497_100058161	3300031226	Soil	GGLASPGTPQDYAAFLAREQEKWSRVVSAIGFKEQNQ
Ga0307408_1012987382	3300031548	Rhizosphere	EEQFSKVGGIASPTTPQQYAAFIASEQAKWSKIVQAIGFKE
Ga0310886_103593071	3300031562	Soil	SKVGGIASPGSPQDYAAFLASEQAKWSAVVTAIGFKEQTQ
Ga0307405_105764831	3300031731	Rhizosphere	KVGGIASPTSPQDYQRFIAAEQTKWSKIVQAIGFKE
Ga0307468_1006765551	3300031740	Hardwood Forest Soil	AVVEQFGKVSGVAAPGTPQDYASFLAAEQAKWSKVVTAIGFKEEN
Ga0310892_104561351	3300031858	Soil	FAKVGGIAAPGTPQEYAAFIAAEQAKWSKIVTAIGFKE
Ga0307406_119524373	3300031901	Rhizosphere	LKSKAVDEQFAKVGGIASPGTPQEYAAFIAAEQAKWSKIVQAIGFKE
Ga0307416_1036801622	3300032002	Rhizosphere	HAAAMASLKSAAVMEQFAKVGGLASPGTPQEYASFLASEQAKWSKVVTAIGFKEQN
Ga0307411_114780361	3300032005	Rhizosphere	AALKSKAVDEQFSKVGGIASPTSPQDYQRFIAAEQAKWSKIVQAIGFKE
Ga0315910_113135652	3300032144	Soil	EEQFSKVGGIASPGTPQDYQAFIAAEQAKWSRIVQAIGFKE
Ga0315910_114758531	3300032144	Soil	AAVAALKSKAVDEQFAKVGGIAAPTTPQEYQRFVAAEQGKWSKIVQAIGFKE
Ga0307471_1009393572	3300032180	Hardwood Forest Soil	GIAFPGTPQDYAAFLAAEQAKWSKVVTAIGFKEQN
Ga0310811_105386411	3300033475	Soil	QLVEQYAKVAGIASPGSPQDYAAFLAREQAKWREVVTAIGFKEQN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign