NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090452

Metagenome / Metatranscriptome Family F090452

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090452
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 44 residues
Representative Sequence DLYGNEVTDAVATYTFDQAGSLYELHSPQTELPRLGIPKS
Number of Associated Samples 94
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.96 %
% of genes near scaffold ends (potentially truncated) 89.81 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.519 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.185 % of family members)
Environment Ontology (ENVO) Unclassified
(28.704 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.370 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 11.76%    Coil/Unstructured: 88.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF07452CHRD 52.78
PF13442Cytochrome_CBB3 12.96
PF16861Carbam_trans_C 2.78
PF04199Cyclase 0.93
PF13360PQQ_2 0.93
PF00107ADH_zinc_N 0.93
PF01799Fer2_2 0.93
PF00155Aminotran_1_2 0.93
PF00702Hydrolase 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.52 %
UnclassifiedrootN/A6.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105049292All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300000789|JGI1027J11758_12395043All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300001431|F14TB_101752019All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300004156|Ga0062589_100349003All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300004479|Ga0062595_100464153All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300004643|Ga0062591_101898301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300005179|Ga0066684_10519134All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005544|Ga0070686_100589242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.875Open in IMG/M
3300005546|Ga0070696_100050950All Organisms → cellular organisms → Bacteria2879Open in IMG/M
3300005546|Ga0070696_100835153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.760Open in IMG/M
3300005549|Ga0070704_102147441All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300005553|Ga0066695_10177276All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300005568|Ga0066703_10055412All Organisms → cellular organisms → Bacteria → Proteobacteria2232Open in IMG/M
3300005598|Ga0066706_11381530All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300005719|Ga0068861_101259014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300005764|Ga0066903_104143329All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005842|Ga0068858_101250049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.730Open in IMG/M
3300005844|Ga0068862_101940104All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300005937|Ga0081455_10474762All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300006358|Ga0068871_100804057All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300006604|Ga0074060_12068194All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300006852|Ga0075433_10997163All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300006854|Ga0075425_102082311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.634Open in IMG/M
3300006854|Ga0075425_102182507All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300006871|Ga0075434_102206901All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300006904|Ga0075424_101914357All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300009137|Ga0066709_100451066All Organisms → cellular organisms → Bacteria → Acidobacteria1798Open in IMG/M
3300009137|Ga0066709_101583242All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300009137|Ga0066709_102152744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.770Open in IMG/M
3300009147|Ga0114129_11343849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria884Open in IMG/M
3300009553|Ga0105249_10468291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1301Open in IMG/M
3300010042|Ga0126314_10946415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300010047|Ga0126382_12382002All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300010362|Ga0126377_11728256All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300010362|Ga0126377_12310650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300010397|Ga0134124_10084176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2740Open in IMG/M
3300010399|Ga0134127_12516141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9594Open in IMG/M
3300010401|Ga0134121_10216603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1662Open in IMG/M
3300012096|Ga0137389_10160010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1850Open in IMG/M
3300012200|Ga0137382_11334861All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300012211|Ga0137377_11946127All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300012212|Ga0150985_113686019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1096Open in IMG/M
3300012469|Ga0150984_108496903All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300012532|Ga0137373_10290055All Organisms → cellular organisms → Bacteria → Acidobacteria1305Open in IMG/M
3300012922|Ga0137394_11300392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300012925|Ga0137419_10869563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.741Open in IMG/M
3300012960|Ga0164301_10058416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2028Open in IMG/M
3300012961|Ga0164302_10684631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.757Open in IMG/M
3300012989|Ga0164305_11198586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300015371|Ga0132258_10185090All Organisms → cellular organisms → Bacteria → Acidobacteria5039Open in IMG/M
3300015371|Ga0132258_11010917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2101Open in IMG/M
3300015372|Ga0132256_101459389All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300015372|Ga0132256_102339025All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300015374|Ga0132255_101282675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300015374|Ga0132255_101588492All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300015374|Ga0132255_102878846All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300015374|Ga0132255_105073606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.557Open in IMG/M
3300017659|Ga0134083_10579105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300017792|Ga0163161_10306958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1251Open in IMG/M
3300018032|Ga0187788_10248384All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300018054|Ga0184621_10082281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1121Open in IMG/M
3300018073|Ga0184624_10002485All Organisms → cellular organisms → Bacteria → Acidobacteria5501Open in IMG/M
3300019883|Ga0193725_1124777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.583Open in IMG/M
3300021078|Ga0210381_10396505All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300021560|Ga0126371_12501578All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300025905|Ga0207685_10659837All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300025907|Ga0207645_10207922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1289Open in IMG/M
3300025911|Ga0207654_10256982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1173Open in IMG/M
3300025922|Ga0207646_11246854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300025934|Ga0207686_11037624All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300025941|Ga0207711_10224063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. Leaf2311721Open in IMG/M
3300025945|Ga0207679_10862314All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300026295|Ga0209234_1025041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2264Open in IMG/M
3300026542|Ga0209805_1052462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2028Open in IMG/M
3300027873|Ga0209814_10449667All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300028380|Ga0268265_12153942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300028381|Ga0268264_11433176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300028714|Ga0307309_10201252All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300028792|Ga0307504_10354151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300028819|Ga0307296_10100648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_91549Open in IMG/M
3300028824|Ga0307310_10119804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1189Open in IMG/M
3300031474|Ga0170818_109148803All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300031562|Ga0310886_10497464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.735Open in IMG/M
3300031720|Ga0307469_10018814All Organisms → cellular organisms → Bacteria → Proteobacteria3688Open in IMG/M
3300031764|Ga0318535_10561526All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300031781|Ga0318547_10706077All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300031858|Ga0310892_11216228All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300031908|Ga0310900_11309201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.606Open in IMG/M
3300031910|Ga0306923_11870606All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300032012|Ga0310902_10177066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1232Open in IMG/M
3300032013|Ga0310906_10827301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.656Open in IMG/M
3300032075|Ga0310890_11223917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.612Open in IMG/M
3300032076|Ga0306924_10263870All Organisms → cellular organisms → Bacteria → Proteobacteria1978Open in IMG/M
3300032174|Ga0307470_10733276All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300032205|Ga0307472_102226760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300032211|Ga0310896_10508440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.661Open in IMG/M
3300032211|Ga0310896_10889703All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300032421|Ga0310812_10213561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9840Open in IMG/M
3300032421|Ga0310812_10251817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300033412|Ga0310810_10118588All Organisms → cellular organisms → Bacteria → Proteobacteria3126Open in IMG/M
3300034115|Ga0364945_0264628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere6.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10504929233300000364SoilDGFADVLGNPVSAAVAKYKFDSVGSLYEVHSPQTELPRLGSPKS*
JGI1027J11758_1239504313300000789SoilPDREEGPADLLGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT*
F14TB_10175201913300001431SoilDLYGNEVSDAVARYTLDPAGSLYELHSPQTELTRLGSPKS*
Ga0063455_10023404433300004153SoilRIADEDVDAYGNEVTTAVAEYSLDGAGDLYELHSPQTELPRLGSPES*
Ga0062589_10034900313300004156SoilDPDREEGPADLFGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT*
Ga0062595_10046415333300004479SoilDVAQSVVDLYGNEVSDAIATYSLDQAGSLYELHSPQTELPRLGAPKS*
Ga0062591_10189830113300004643SoilDLYGNEVTDAVATYTFDQAGSLYELHSPQTELPRLGIPKS*
Ga0066684_1051913423300005179SoilMDVYGNQVTAAVATYEFDATGTLYELHSPQTEIPRLGSPKS*
Ga0070676_1055195413300005328Miscanthus RhizosphereGDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS*
Ga0070698_10036730343300005471Corn, Switchgrass And Miscanthus RhizosphereDPRADRGSGFTDDEDEVTDVYGNGITAAVASYKYDATGTLYELHSPQTELPRLAAPKS*
Ga0070698_10184060523300005471Corn, Switchgrass And Miscanthus RhizosphereSGDRGSDLTEDEVMDVYGNEVTAAVATYKVDAAGTLYELHSPQTELPRLAAPKS*
Ga0070686_10058924233300005544Switchgrass RhizospherePVEGAPIEDAATDMYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS*
Ga0070696_10005095013300005546Corn, Switchgrass And Miscanthus RhizosphereFTDLYGNEVTDAIATYTFDQSGSLYELHSPQTELPRLGIPKS*
Ga0070696_10083515313300005546Corn, Switchgrass And Miscanthus RhizosphereGAVVDLYGNEVTDAIATYSIDPAGSVYELHSPQTEVPRLGSPKS*
Ga0070704_10214744123300005549Corn, Switchgrass And Miscanthus RhizospherePNDAFTDLYGNEVSDAIATYKFDQSGSLYELHSPQTELPRLGIPKS*
Ga0066695_1017727613300005553SoilGDDMPENLDLYGNEVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT*
Ga0066703_1005541213300005568SoilTDDNEGTVDLFGNEVTDAVAKYKTDATGSLYELHSPQTELPRLGSPKT*
Ga0066706_1138153013300005598SoilLYGNEVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT*
Ga0068861_10125901423300005719Switchgrass RhizosphereSNDAFTDLYGNEVNDALATYTLDQAGSLYELHSPQTELPRLGIPKS*
Ga0066903_10414332933300005764Tropical Forest SoilDISGNEVTPAVATYSIDALGSPYELHSPQTELPRLGSPKS*
Ga0068858_10125004933300005842Switchgrass RhizosphereVDLYGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS*
Ga0068862_10194010413300005844Switchgrass RhizosphereMDTEDDVDAYGNEVTPAVAEYSLDPAGSPYERHSPQTELPRLGSPKS*
Ga0081455_1047476233300005937Tabebuia Heterophylla RhizosphereAAVDLVGNKVNAAVAKYKFDAAGSLYELHSPQTEVPRLRSPKT*
Ga0068871_10080405733300006358Miscanthus RhizosphereEPNEDEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS*
Ga0074060_1206819413300006604SoilGGEPNEDEAMDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS*
Ga0075433_1099716333300006852Populus RhizosphereNEVTDAIATYGVDPAGSLYELHSPQTELPRLGSPKS*
Ga0075425_10208231113300006854Populus RhizosphereATDVYGNRVTPAVATYQLDAAGMPYELHSPQTQLPRLGSPKS*
Ga0075425_10218250713300006854Populus RhizosphereGNRVTDAVAKYKFDATGTLYESHSPQTELPRLAPPKT*
Ga0075434_10220690123300006871Populus RhizosphereDLLGNPVSDAIAKYKLDPAGGLYELHSPQTELPRLAAPKS*
Ga0075424_10191435713300006904Populus RhizosphereEVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT*
Ga0066709_10045106613300009137Grasslands SoilINDAVAKYQYDAAGLVYELHSPETEVPKLAPPKT*
Ga0066709_10158324213300009137Grasslands SoilDDALGLYGNEVIDAVATYSLDPTGSLYELHSPQTELPRLASPKS*
Ga0066709_10215274433300009137Grasslands SoilVYGNEVTAAVATYEIDATGSLYELHSPQTQLPRLGSPKS*
Ga0114129_1134384913300009147Populus RhizosphereIDLYGNGVSPAVATYSLDALGSLYEEHSPQTELPRLGSPKT*
Ga0105249_1046829133300009553Switchgrass RhizosphereGDSNDAFTDLYGNEVNDALATYTFDQAGSLYELHSPQTELPRLGIPKS*
Ga0126314_1094641513300010042Serpentine SoilAGQPGDGFTDVYGNEINDAVATYTLDPSGSLYELHSPQTELPRLGIPKS*
Ga0126382_1238200213300010047Tropical Forest SoilTVDRYGNEVIDAVATYSLDPTGSLYEMHSPQTELPRLPSPKS*
Ga0126377_1172825613300010362Tropical Forest SoilGDGPVDLQDNEVTDAVATYKLDATGSLYETHSPQTELPRLGSPKS*
Ga0126377_1231065013300010362Tropical Forest SoilYWFEVNDAISTYTFFPGGSLYELHSPQTEVPRLGSPKS*
Ga0134124_1008417633300010397Terrestrial SoilVTPAVATYQLDAAGMPYELHSPQTQVPRLGSPKS*
Ga0134127_1251614113300010399Terrestrial SoilGSADLYGNEVIEAVATFKLDEAGSLYEVHSPQTELPQLGSPQG*
Ga0134121_1021660313300010401Terrestrial SoilNEVTPAVAEYSLDPAGSPYELHSPQTELPRLGSPKS*
Ga0137389_1016001043300012096Vadose Zone SoilDATDVYGNEVTAAVAKYKFDATGTLYELHSPQTELPRLASPKS*
Ga0137382_1133486113300012200Vadose Zone SoilDLYGNEVTDAVAKYRFDATGSLYELHSPQTEVPKLAPPKT*
Ga0137377_1194612723300012211Vadose Zone SoilEVTDAVAKYRFDATGSLYELHSPQTEVPKLAPPKT*
Ga0150985_11368601913300012212Avena Fatua RhizosphereDLYGNEVSDAIATYSLDPTGSLYELHSPQTELPRLAEPKS*
Ga0150984_10849690333300012469Avena Fatua RhizosphereLYGNEVSDAIATYSLDPTGSLYELHSPQTELPRLAEPKS*
Ga0137373_1029005533300012532Vadose Zone SoilGNEITPAVAKYSFDATGSLYELHSPQTELPRLGSPKS*
Ga0137394_1130039223300012922Vadose Zone SoilEVTDAMAEYTIDPAGSLYELHSPQTELPRLGIPKS*
Ga0137419_1086956313300012925Vadose Zone SoilNEVTVAVAKYRLDATGAQYELHSPQTELPRRAPPRS*
Ga0164301_1005841613300012960SoilMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS*
Ga0164302_1068463123300012961SoilEALDMYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS*
Ga0164305_1119858623300012989SoilYGNEVSDAIATYSLDPTGSLYELHSPQTELPRLGEPKS*
Ga0132258_1018509043300015371Arabidopsis RhizosphereVSGQEQGDADGPVDLLGNEVTDAVAKYKFDATGSLYETHSPQTELPRLSSPKS*
Ga0132258_1101091713300015371Arabidopsis RhizosphereTPDAEGPVDLYGNEVTDAVAKYKFDATGSLYETHSPQTELPRLASPKS*
Ga0132258_1268255513300015371Arabidopsis RhizosphereVADVPPSHHTRFDPKDTAVDLYGNEVDDAIATYSIDPAGSPYEVHSPQTELPRLGSPKS*
Ga0132256_10145938933300015372Arabidopsis RhizosphereIRDAEEDFLVDLYGNEVTPAVATYTFDDLGTLYEVHSPQTEVPRLGSPKS*
Ga0132256_10233902523300015372Arabidopsis RhizosphereVSGQEQGDADGPVDLLGNEVTDAVAKYKFDATGSLYETHSPQTELPRLASPKS*
Ga0132255_10128267533300015374Arabidopsis RhizosphereADVLIDLYGNDVSPAVATYSFDALGSLYEEHSPQTELPRLGSPKT*
Ga0132255_10158849213300015374Arabidopsis RhizosphereIDRYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS*
Ga0132255_10287884613300015374Arabidopsis RhizosphereDVSPAVAEYSVDPLGSPYEVHSPQTELPRLASPQS*
Ga0132255_10507360613300015374Arabidopsis RhizosphereDLFGNPVTDAVARYKCDATGSLYELHSPQTEVPKLRPPKT*
Ga0134083_1057910523300017659Grasslands SoilVTPTSRDGAPDDAVDAYGNEVTDAVAQYTLDGAGTLYELHSPQVELPRLGSPKS
Ga0163161_1030695833300017792Switchgrass RhizosphereDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS
Ga0187788_1024838413300018032Tropical PeatlandSGTENGDSDVDLLGNPVADAVAKYEFDTTGSLYELHSPQTELPRLADPKG
Ga0184621_1008228133300018054Groundwater SedimentDDPTDVYGNEVTAAVAKYKFDATGTLYELHSPQTELPRLASPKS
Ga0184624_1000248513300018073Groundwater SedimentEDEATDVYGNRVTPAVATYQLDAAGALYELHSPQTQLPRLGSPKS
Ga0193725_112477723300019883SoilNEVTAAVATYKFDATGMLYELHSPQTELPRLASPKS
Ga0210381_1039650513300021078Groundwater SedimentFDEADGVLDLYGNEVSDAVARYTLDPAGSLYELHSPQTELPRLGSPKS
Ga0126371_1250157813300021560Tropical Forest SoilSPDEPTSTVDLFGNDVSDAVAEYRLDATGSLYEVHSPQTEIPKLASPKS
Ga0207685_1065983713300025905Corn, Switchgrass And Miscanthus RhizosphereTDLFGNPVTDAVARYKFDATGSLYELHSPQTEVPRLRPPKT
Ga0207645_1020792233300025907Miscanthus RhizosphereGDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS
Ga0207654_1025698233300025911Corn RhizosphereYGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS
Ga0207646_1124685413300025922Corn, Switchgrass And Miscanthus RhizosphereVDLYGNEVTDAIATYSIDPAGSLYELHSPQTEVPRLGSPKS
Ga0207686_1103762423300025934Miscanthus RhizosphereMGNEVTDAVAKYKLDATGSLYETHSPQTELPRLGS
Ga0207669_1143246313300025937Miscanthus RhizosphereSEPGDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS
Ga0207711_1022406313300025941Switchgrass RhizosphereLYGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS
Ga0207679_1086231413300025945Corn RhizosphereYGNEVSAAVAKYKLDGRGALYELHSPQTELPQLAPPRS
Ga0207677_1228742513300026023Miscanthus RhizosphereRSDRPDEAAGFTDLYGNEVTDAVATYTFDRSGSLYELHSPQTELPRLGIPKS
Ga0209234_102504113300026295Grasslands SoilNEGTVDLFGNEVTDAVAKYKTDATGSLYELHSPQTELPRLGSPKT
Ga0209805_105246233300026542SoilRPGDEGGVVDLYGNEVSDAIATYSIDPAGSLYELHSPQTEVPRLGSPKS
Ga0209814_1044966713300027873Populus RhizosphereVYGNEVSSAVAQYKLDATGTMYELHSPQTELPRLGSPKS
Ga0268265_1215394223300028380Switchgrass RhizosphereLYGNEVSDAVATYTFDQSGSLYELHSPQTELPRLGIPKS
Ga0268264_1143317623300028381Switchgrass RhizospherePIDMYGNEVSDAVAKYKLDATGALYELHSPQTEVPRLGAPKG
Ga0307309_1020125223300028714SoilDLGRDLTEDEVMDVYGNGITAAVATYKYDATGTLYELHSPQTELPRLASPKS
Ga0307504_1035415113300028792SoilAPRDEPGGATDLYGNEVTDAVARYTLDPAGSLYELHSPQTELPHLGIPKS
Ga0307296_1010064813300028819SoilDLYGNEVSDAVARFKLDDAGSLYEVHSPQTELPRLASPIS
Ga0307310_1011980413300028824SoilVDLYGNEVSDAVARYTLDPAGSLYELHSPQTELTRLGSPKS
Ga0170818_10914880313300031474Forest SoilPAPAQLNLTPRDETTDEGAVDLYGNETTDAVARYKLDAEGSLYELHSPRTELPRLGSPKS
Ga0310886_1049746433300031562SoilAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS
Ga0307469_1001881413300031720Hardwood Forest SoilLYGNVVTDAIATYSIDPAGSLYELHSPQTEVPRLDSPKS
Ga0318535_1056152623300031764SoilLYGNDVSDAVAKYSLDATGVLYEVHSPQTEIPRLASPKS
Ga0318547_1070607723300031781SoilVDLYGNDVSDAVAKYSLDATGVLYEVHSPQTEIPRLASPKS
Ga0310892_1121622813300031858SoilSQPPSAGDDADDADADVLGNPVSDAVAKYKFDATGSLYELHSPQTELPRLADPKS
Ga0310900_1130920113300031908SoilDPDREEGPADLFGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT
Ga0306923_1187060613300031910SoilMIDLYGNDVTAAVAKYSIDATGSLYEVHSPQTEIPKLGSPKT
Ga0310902_1017706633300032012SoilDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS
Ga0310906_1082730123300032013SoilDEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS
Ga0310890_1122391713300032075SoilEDEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS
Ga0306924_1026387013300032076SoilDTDRDGMIDLYGNDVTAAVAKYSIDATGSLYEVHSPQTEIPKLGSPKT
Ga0307470_1073327623300032174Hardwood Forest SoilEIDLYGNDVSDAVAKYKLDSDGSLYELHSPQTQLPHLGSSKT
Ga0307472_10222676023300032205Hardwood Forest SoilLYGNEVTDAVATYTFDKSGSLYELHSPQTELPRLGIPKS
Ga0310896_1050844013300032211SoilEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS
Ga0310896_1088970313300032211SoilDPDPEEGPADLFGNPVTDAVARYKCDATGSLYELHSPQTEVPKLRPPKT
Ga0310812_1021356123300032421SoilGSSDLFGNEISDAVARYTLDETGALYEVHSPETELPRLTSPVG
Ga0310812_1025181733300032421SoilDEVIDVYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS
Ga0310810_1011858813300033412SoilAVDGAVDLYGNEVNDAFATYSLDPGGSLYEVHSPQTELPRLGSPKS
Ga0364945_0264628_390_5303300034115SedimentGASGFTDLYGNEITDAIATYTFDRSGSLYELHSPQTEIPRLGSPKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.